Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2754.t1
Gene name
Locationscaffold_03:870685..873391
Strand-
Gene length (bp)2706
Transcript length (bp)2436
Coding sequence length (bp)2436
Protein length (aa) 812

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00225 Kinesin Kinesin motor domain 2.2E-60 39 573
PF16796 Microtub_bd Microtubule binding 1.9E-09 42 149

GO

GO Term Description Terminal node
GO:0008017 microtubule binding Yes
GO:0003777 microtubule motor activity Yes
GO:0005524 ATP binding Yes
GO:0007018 microtubule-based movement Yes
GO:0005488 binding No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0008150 biological_process No
GO:0017076 purine nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0140657 ATP-dependent activity No
GO:0030554 adenyl nucleotide binding No
GO:0015631 tubulin binding No
GO:0007017 microtubule-based process No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0005515 protein binding No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0008092 cytoskeletal protein binding No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0009987 cellular process No
GO:0003774 cytoskeletal motor activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 30.07 17.90 42.24
5d_25C Five days - 25 degrees Celsius 17.86 9.86 25.86
7d_25C Seven days - 25 degrees Celsius 16.75 9.00 24.51
10d_25C Ten days - 25 degrees Celsius 12.24 6.29 18.18
7d_15C Seven days - 15 degrees Celsius 19.08 9.71 28.46
7d_30C Seven days - 30 degrees Celsius 20.37 11.35 29.38

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.017204 yes
3d_25C 7d_25C 0.010411 yes
3d_25C 7d_15C 0.071362 no
3d_25C 7d_30C 0.098152 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.864516 no
5d_25C 7d_15C 0.865499 no
5d_25C 7d_30C 0.682768 no
5d_25C 10d_25C 0.158286 no
7d_25C 7d_15C 0.714057 no
7d_25C 7d_30C 0.519877 no
7d_25C 10d_25C 0.269587 no
7d_15C 7d_30C 0.868295 no
7d_15C 10d_25C 0.106871 no
7d_30C 10d_25C 0.041216 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2754.t1
MPPKQPQTSLFQVYLRLRPPMTPNPNECDRFLNVEAPEASQEETEIVSPASTHVTLQPPNDTRKRAVERFGFTKV
FEETASQLDVFHDTGMEPIIRGVLKENRDGLVATLGVTGSGKSHTILGSKTQRGMTQMALDVIFRSLESTNKTDH
GSITPVMLASLAVADASEAQLFSAQTFLEAVYGEPNGRTSRAQTPMSPSRANTPLTVRNPFTLNSPQGSPTPRPS
TPGSFLPRPRSKSGSPHKMDLSHITSPHDAAGSGLGQISTEPSGWITPGFSNPIPYTHCNLFEPKSAKSRLYVFK
EPTPALNFPRRHIRERPCALPRLPDMSHLTVDMDSNADYVVLVSMYEVYNDRIFDLLSPSIASGQGNMSRGNNQK
DRRRPLLFKSTEGSPDRKLVAGLRKIACSSYEEALAILDVGLTERKVTGTGMNSVSSRSHGFFSLEVKKRTYSKR
TGEQNWAGNALTVVDLAGSERARTAKTAGATLAEAGKINESLMYLGQCLQMQSNIQDGMKTALVPYRQCKLTELL
FSNSFPSSHQMSRGQYPQKAIMIVTADPVGDFNATSQILRYSALAREVTVPRIPSICESILSAASGSHRSISGST
SPNFDSAEELERAAAEITRLTRDCHGLAVKLAEEEIARADVEMRLSAAEERCLMIEQDVREECWAEMDEKMEEER
RRWQRAWDEQIGRNDEHIDKKVELVSRGFQIFEDSASNERVEELEQENDQLRRKLAAFEREMHNQSPTRKNRPKN
ATSARSNPLGRGSDVENALQRMDQLKLADTMFAPPSPGSSPIKKTRKMGTRKWDLAPEDQI*
Coding >Pro_DTO377G3_2|g2754.t1
ATGCCGCCAAAACAGCCCCAGACATCGCTGTTCCAAGTTTACCTTCGGTTACGCCCCCCGATGACCCCAAACCCC
AATGAATGTGACCGCTTTTTGAACGTTGAGGCGCCAGAGGCTTCGCAGGAGGAAACAGAGATCGTCTCGCCTGCA
TCAACACATGTTACTCTTCAACCACCAAATGACACGAGAAAGCGCGCCGTCGAGAGGTTTGGTTTCACAAAGGTC
TTCGAGGAGACCGCCTCGCAACTGGATGTCTTCCATGACACTGGGATGGAGCCCATCATACGTGGAGTACTGAAG
GAGAACCGAGATGGCCTAGTGGCTACCCTGGGAGTCACAGGCAGTGGAAAGAGCCACACCATTTTAGGATCCAAG
ACCCAACGGGGAATGACCCAAATGGCACTTGACGTTATCTTCCGCTCTTTAGAGTCGACAAATAAGACCGATCAT
GGTAGCATTACCCCCGTGATGCTTGCCTCGCTGGCTGTCGCGGACGCTTCTGAAGCCCAATTGTTCTCCGCCCAA
ACATTTCTGGAAGCTGTATATGGCGAACCAAACGGACGTACATCGAGAGCGCAAACACCGATGAGCCCATCTCGC
GCCAATACCCCTTTGACGGTACGAAACCCCTTTACGCTGAACTCCCCCCAAGGATCCCCAACCCCACGACCAAGC
ACCCCTGGATCGTTTCTCCCAAGACCGAGATCTAAATCTGGAAGCCCCCACAAGATGGATTTGTCTCATATTACC
AGTCCCCATGACGCTGCTGGATCTGGCCTTGGCCAGATCTCAACTGAGCCCTCTGGATGGATCACCCCAGGATTT
TCTAATCCTATCCCCTACACCCACTGCAATCTATTTGAGCCCAAATCAGCTAAATCTCGACTTTATGTCTTCAAG
GAACCCACGCCTGCCTTGAACTTTCCTCGCCGTCACATACGTGAACGACCATGCGCCCTTCCTAGGCTGCCCGAT
ATGAGCCACCTAACTGTAGATATGGACTCAAATGCCGACTATGTCGTTTTGGTGTCAATGTACGAAGTATACAAT
GACCGGATCTTTGATCTTCTGTCTCCATCAATTGCCTCGGGTCAGGGTAACATGTCCCGCGGAAATAACCAAAAG
GATCGGCGACGTCCCTTGCTCTTCAAGTCTACCGAGGGCTCACCAGATCGGAAACTGGTTGCCGGGCTACGCAAA
ATTGCTTGCAGCAGCTATGAGGAAGCACTGGCCATTTTGGATGTTGGTTTAACTGAACGCAAGGTAACTGGCACT
GGAATGAATAGCGTTAGCTCTCGAAGCCATGGCTTCTTTTCCCTGGAAGTCAAGAAACGGACATACTCAAAGCGA
ACTGGTGAACAAAACTGGGCTGGAAACGCCCTCACGGTTGTGGATCTCGCTGGCTCCGAGCGTGCGAGAACAGCA
AAGACAGCTGGTGCCACACTTGCTGAGGCCGGCAAGATTAACGAAAGTTTGATGTACCTCGGCCAATGCCTGCAG
ATGCAAAGCAACATACAGGATGGAATGAAGACCGCTCTCGTTCCTTACAGACAGTGCAAATTGACCGAGCTTTTG
TTTTCGAATTCATTCCCATCATCTCACCAGATGTCCAGAGGCCAATATCCCCAGAAGGCTATCATGATCGTCACC
GCTGACCCTGTGGGTGATTTCAACGCCACCTCCCAAATTTTGCGTTACTCCGCATTGGCTCGTGAGGTTACGGTT
CCTAGAATTCCCTCGATCTGTGAATCTATTCTGTCTGCCGCTTCTGGCAGTCACCGCTCAATCAGTGGGTCCACT
TCGCCAAATTTTGATTCAGCCGAAGAGCTCGAGAGAGCTGCTGCTGAGATCACACGCCTCACACGCGATTGTCAC
GGCCTTGCTGTCAAGCTAGCCGAAGAAGAGATTGCACGGGCTGATGTTGAGATGAGATTAAGCGCTGCCGAAGAA
AGATGTCTTATGATCGAGCAAGATGTGCGAGAAGAATGCTGGGCAGAGATGGATGAGAAAATGGAAGAGGAAAGG
CGACGCTGGCAGAGAGCATGGGATGAGCAGATCGGTCGCAATGACGAGCACATCGACAAGAAGGTTGAGCTTGTA
TCCCGCGGATTTCAAATCTTTGAGGATTCGGCGTCGAACGAACGAGTGGAAGAGCTTGAGCAAGAAAACGACCAG
CTTCGCCGCAAACTCGCCGCTTTTGAGCGTGAGATGCACAACCAATCCCCGACAAGAAAGAATAGACCCAAGAAT
GCCACGTCCGCGCGGTCTAATCCCCTCGGCCGCGGTAGCGACGTTGAAAACGCTTTGCAACGCATGGATCAATTG
AAGCTTGCAGATACCATGTTTGCTCCTCCATCGCCAGGATCCTCGCCTATCAAGAAGACGAGGAAGATGGGAACT
CGGAAATGGGACCTCGCCCCAGAGGACCAGATCTAA
Transcript >Pro_DTO377G3_2|g2754.t1
ATGCCGCCAAAACAGCCCCAGACATCGCTGTTCCAAGTTTACCTTCGGTTACGCCCCCCGATGACCCCAAACCCC
AATGAATGTGACCGCTTTTTGAACGTTGAGGCGCCAGAGGCTTCGCAGGAGGAAACAGAGATCGTCTCGCCTGCA
TCAACACATGTTACTCTTCAACCACCAAATGACACGAGAAAGCGCGCCGTCGAGAGGTTTGGTTTCACAAAGGTC
TTCGAGGAGACCGCCTCGCAACTGGATGTCTTCCATGACACTGGGATGGAGCCCATCATACGTGGAGTACTGAAG
GAGAACCGAGATGGCCTAGTGGCTACCCTGGGAGTCACAGGCAGTGGAAAGAGCCACACCATTTTAGGATCCAAG
ACCCAACGGGGAATGACCCAAATGGCACTTGACGTTATCTTCCGCTCTTTAGAGTCGACAAATAAGACCGATCAT
GGTAGCATTACCCCCGTGATGCTTGCCTCGCTGGCTGTCGCGGACGCTTCTGAAGCCCAATTGTTCTCCGCCCAA
ACATTTCTGGAAGCTGTATATGGCGAACCAAACGGACGTACATCGAGAGCGCAAACACCGATGAGCCCATCTCGC
GCCAATACCCCTTTGACGGTACGAAACCCCTTTACGCTGAACTCCCCCCAAGGATCCCCAACCCCACGACCAAGC
ACCCCTGGATCGTTTCTCCCAAGACCGAGATCTAAATCTGGAAGCCCCCACAAGATGGATTTGTCTCATATTACC
AGTCCCCATGACGCTGCTGGATCTGGCCTTGGCCAGATCTCAACTGAGCCCTCTGGATGGATCACCCCAGGATTT
TCTAATCCTATCCCCTACACCCACTGCAATCTATTTGAGCCCAAATCAGCTAAATCTCGACTTTATGTCTTCAAG
GAACCCACGCCTGCCTTGAACTTTCCTCGCCGTCACATACGTGAACGACCATGCGCCCTTCCTAGGCTGCCCGAT
ATGAGCCACCTAACTGTAGATATGGACTCAAATGCCGACTATGTCGTTTTGGTGTCAATGTACGAAGTATACAAT
GACCGGATCTTTGATCTTCTGTCTCCATCAATTGCCTCGGGTCAGGGTAACATGTCCCGCGGAAATAACCAAAAG
GATCGGCGACGTCCCTTGCTCTTCAAGTCTACCGAGGGCTCACCAGATCGGAAACTGGTTGCCGGGCTACGCAAA
ATTGCTTGCAGCAGCTATGAGGAAGCACTGGCCATTTTGGATGTTGGTTTAACTGAACGCAAGGTAACTGGCACT
GGAATGAATAGCGTTAGCTCTCGAAGCCATGGCTTCTTTTCCCTGGAAGTCAAGAAACGGACATACTCAAAGCGA
ACTGGTGAACAAAACTGGGCTGGAAACGCCCTCACGGTTGTGGATCTCGCTGGCTCCGAGCGTGCGAGAACAGCA
AAGACAGCTGGTGCCACACTTGCTGAGGCCGGCAAGATTAACGAAAGTTTGATGTACCTCGGCCAATGCCTGCAG
ATGCAAAGCAACATACAGGATGGAATGAAGACCGCTCTCGTTCCTTACAGACAGTGCAAATTGACCGAGCTTTTG
TTTTCGAATTCATTCCCATCATCTCACCAGATGTCCAGAGGCCAATATCCCCAGAAGGCTATCATGATCGTCACC
GCTGACCCTGTGGGTGATTTCAACGCCACCTCCCAAATTTTGCGTTACTCCGCATTGGCTCGTGAGGTTACGGTT
CCTAGAATTCCCTCGATCTGTGAATCTATTCTGTCTGCCGCTTCTGGCAGTCACCGCTCAATCAGTGGGTCCACT
TCGCCAAATTTTGATTCAGCCGAAGAGCTCGAGAGAGCTGCTGCTGAGATCACACGCCTCACACGCGATTGTCAC
GGCCTTGCTGTCAAGCTAGCCGAAGAAGAGATTGCACGGGCTGATGTTGAGATGAGATTAAGCGCTGCCGAAGAA
AGATGTCTTATGATCGAGCAAGATGTGCGAGAAGAATGCTGGGCAGAGATGGATGAGAAAATGGAAGAGGAAAGG
CGACGCTGGCAGAGAGCATGGGATGAGCAGATCGGTCGCAATGACGAGCACATCGACAAGAAGGTTGAGCTTGTA
TCCCGCGGATTTCAAATCTTTGAGGATTCGGCGTCGAACGAACGAGTGGAAGAGCTTGAGCAAGAAAACGACCAG
CTTCGCCGCAAACTCGCCGCTTTTGAGCGTGAGATGCACAACCAATCCCCGACAAGAAAGAATAGACCCAAGAAT
GCCACGTCCGCGCGGTCTAATCCCCTCGGCCGCGGTAGCGACGTTGAAAACGCTTTGCAACGCATGGATCAATTG
AAGCTTGCAGATACCATGTTTGCTCCTCCATCGCCAGGATCCTCGCCTATCAAGAAGACGAGGAAGATGGGAACT
CGGAAATGGGACCTCGCCCCAGAGGACCAGATCTAA
Gene >Pro_DTO377G3_2|g2754.t1
ATGCCGCCAAAACAGCCCCAGACATCGCTGTTCCAAGTTTACCTTCGGTTACGCCCCCCGATGACCCCAAACCCC
AATGAATGTGACCGCTTTTTGAACGTTGAGGCGCCAGAGGCTTCGCAGGAGGAAACAGAGATCGTCTCGCCTGCA
TCAACACATGTTACTCTTCAACCACCAAATGACACGAGAAAGCGCGCCGTCGAGAGGTTTGGTTTCACAAAGGTC
TTCGAGGAGACCGCCTCGCAACTGGATGTCTTCCATGACACTGGGATGGAGCCCATCATACGTGGAGTACTGAAG
GAGAACCGAGATGGCCTAGTGGCTACCCTGGGAGTCACAGGCAGTGGAAAGGTCTAGTCCCGTGTATTGTAATAT
CGCGATAACCAAGCTAACGGGTTGATCATACACAGAGCCACACCATTTTAGGATCCAAGACCCAACGGGGAATGA
CCCAAATGGCACTTGACGTTATCTTCCGCTCTTTAGAGTCGACAAATAAGACCGATCATGGTAGCATTACCCCCG
TGATGCTTGCCTCGCTGGCTGTCGCGGACGCTTCTGAAGCCCAATTGTTCTCCGCCCAAACATTTCTGGAAGCTG
TATATGGCGAACCAAACGGACGTACATCGAGAGCGCAAACACCGATGAGCCCATCTCGCGCCAATACCCCTTTGA
CGGTACGAAACCCCTTTACGCTGAACTCCCCCCAAGGATCCCCAACCCCACGACCAAGCACCCCTGGATCGTTTC
TCCCAAGACCGAGATCTAAATCTGGAAGCCCCCACAAGATGGATTTGTCTCATATTACCAGTCCCCATGACGCTG
CTGGATCTGGCCTTGGCCAGATCTCAACTGAGCCCTCTGGATGGATCACCCCAGGATTTTCTAATCCTATCCCCT
ACACCCACTGCAATCTATTTGAGCCCAAATCAGCTAAATCTCGACTTTATGTCTTCAAGGAACCCACGCCTGCCT
TGAACTTTCCTCGCCGTCACATACGTGAACGACCATGCGCCCTTCCTAGGCTGCCCGATATGAGCCACCTAACTG
TAGATATGGACTCAAATGCCGACTATGTCGTTTTGGTGTCAATGTACGAAGTATACAATGACCGGATCTTTGATC
TTCTGTCTCCATCAATTGCCTCGGGTCAGGGTAACATGTCCCGCGGAAATAACCAAAAGGATCGGCGACGTCCCT
TGCTCTTCAAGTCTACCGAGGGCTCACCAGATCGGAAACTGGTTGCCGGGCTACGCAAAATTGCTTGCAGCAGCT
ATGAGGAAGCACTGGCCATTTTGGATGTTGGTTTAACTGAACGCAAGGTAACTGGCACTGGAATGAATAGCGTTA
GCTCTCGAAGCCATGGCTTCTTTTCCCTGGAAGTCAAGAAACGGACATACTCAAAGCGAACTGGTGAACAAAACT
GGGCTGGAAACGCCCTCACGGTTGTGGATCTCGCTGGTAAGTAGATTACATTCTTACTGTAAGTCTGTAACTAAT
CAATCTAGGCTCCGAGCGTGCGAGAACAGCAAAGACAGCTGGTGCCACACTTGCTGAGGCCGGCAAGATTAACGA
AAGTTTGATGTACCTCGGCCAATGCCTGCAGATGCAAAGCAACATACAGGATGGAATGAAGGTATGTTTGGAACT
CATAGTTAGTGTGCTCTTTTTGGCAGCTGCTAACCTACAAAGACCGCTCTCGTTCCTTACAGACAGTGCAAATTG
ACCGAGCTTTTGTTTTCGAATTCATTCCCATCATCTCACCAGATGTCCAGAGGCCAATATCCCCAGAAGGCTATC
ATGATCGTCACCGCTGACCCTGTGGGTGATTTCAACGCCACCTCCCAAATTTTGCGTTACTCCGCATTGGCTCGT
GAGGTTACGGTTCCTAGAATTCCCTCGATCTGTGAATCTATTCTGTCTGCCGCTTCTGGCAGTCACCGCTCAATC
AGTGGGTCCACTTCGCCAAATTTTGATTCAGCCGAAGAGCTCGAGAGAGCTGCTGCTGAGATCACACGCCTCACA
CGCGATTGTCACGGCCTTGCTGTCAAGCTAGCCGAAGAAGAGATTGCACGGGCTGATGTTGAGATGAGATTAAGC
GCTGCCGAAGAAAGATGTCTTATGATCGAGCAAGATGTGCGAGAAGAATGCTGGGCAGAGATGGATGAGAAAATG
GAAGAGGAAAGGCGACGCTGGCAGAGAGCATGGGATGAGCAGGTTCGTAGCCGTGGATCAGCTCAAAACTTGCAA
AATGCTAATAAACCCAGATCGGTCGCAATGACGAGCACATCGACAAGAAGGTTGAGCTTGTATCCCGCGGATTTC
AAAGTAAGTCTGCCATTGAGGAGCGAAATATGATAACTCTTAAACTGACCTTTCTCTCCAGTCTTTGAGGATTCG
GCGTCGAACGAACGAGTGGAAGAGCTTGAGCAAGAAAACGACCAGCTTCGCCGCAAACTCGCCGCTTTTGAGCGT
GAGATGCACAACCAATCCCCGACAAGAAAGAATAGACCCAAGAATGCCACGTCCGCGCGGTCTAATCCCCTCGGC
CGCGGTAGCGACGTTGAAAACGCTTTGCAACGCATGGATCAATTGAAGCTTGCAGATACCATGTTTGCTCCTCCA
TCGCCAGGATCCTCGCCTATCAAGAAGACGAGGAAGATGGGAACTCGGAAATGGGACCTCGCCCCAGAGGACCAG
ATCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail