Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2742.t1
Gene name
Locationscaffold_03:838118..839495
Strand+
Gene length (bp)1377
Transcript length (bp)1197
Coding sequence length (bp)1197
Protein length (aa) 399

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03151 TPT Triose-phosphate Transporter family 4.3E-25 39 326

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 33 55 22
2 65 87 22
3 107 129 22
4 134 156 22
5 163 180 17
6 184 206 22
7 219 241 22
8 256 278 22
9 283 305 22
10 309 326 17
11 357 379 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2742.t1
MSDGEKVRASGETPREQSLPTVNPAAEKTEQPGITFHPAVYVTTWITLSSTVILFNKYLLDYANFRFPIILTTWH
LSFATVMTQILARTTTVLDGRKKVKMTGRVYLRAIVPIGIMFSLSLICGNMTYLYLSVAFIQMLKATTPVAVLLA
TWGMGMAPANMKVLANVSIIVIGVIIASFGEIKFNMVGFLFQLGGIVFEATRLVMVQGLLSSADFKMDPMVSLYY
FAPICAVMNGVVALFLEFPHVTMDHVYSVGIWLLVLNAVVAFLLNVSVVFLIGKTSSLVMTLCGVLKDILLVAAS
MFLWQTPVTGLQFFGYSIALLGLVWYKLGGDKMREYTSSAGRAWADYGNNRPAQRKFVVFGAAALIFFLFVGSMA
PSYANDSVDRVKGYLGGATAGNA*
Coding >Pro_DTO377G3_2|g2742.t1
ATGAGCGACGGCGAGAAGGTCCGCGCCTCTGGCGAGACTCCCCGGGAGCAGTCTTTGCCTACTGTCAACCCCGCA
GCGGAGAAGACAGAGCAGCCGGGCATTACATTCCACCCCGCGGTCTATGTGACTACATGGATCACCTTGAGTTCC
ACTGTTATCCTGTTCAACAAGTACCTCCTCGACTATGCCAACTTCCGTTTCCCCATCATCCTCACAACATGGCAT
CTGTCTTTCGCTACTGTCATGACCCAAATCCTCGCTCGCACCACTACTGTCCTCGATGGCCGCAAGAAGGTCAAG
ATGACCGGCCGTGTCTACCTCCGCGCTATCGTCCCTATCGGTATAATGTTCAGTCTGAGCTTGATTTGCGGTAAC
ATGACCTACCTCTACCTGAGCGTTGCCTTTATCCAAATGCTCAAGGCCACCACCCCTGTGGCTGTTCTCCTCGCA
ACCTGGGGTATGGGCATGGCTCCGGCCAACATGAAGGTCCTGGCCAACGTCTCCATCATCGTGATCGGTGTGATC
ATTGCCTCCTTCGGTGAGATCAAGTTCAACATGGTCGGTTTCCTGTTCCAGCTCGGTGGTATCGTTTTCGAGGCC
ACCCGTCTGGTCATGGTACAGGGTCTGCTTAGCTCCGCCGACTTTAAGATGGACCCCATGGTTTCTCTGTACTAC
TTCGCCCCCATCTGTGCCGTCATGAACGGTGTCGTTGCTCTGTTCTTGGAATTCCCCCATGTCACCATGGACCAT
GTCTACTCCGTTGGTATCTGGCTTCTAGTTCTCAATGCCGTTGTGGCTTTCCTGCTCAACGTCTCGGTCGTTTTC
CTGATTGGCAAGACCTCTTCCCTGGTCATGACTCTGTGCGGTGTCCTCAAGGATATCCTATTGGTTGCTGCCTCC
ATGTTCCTGTGGCAGACTCCCGTCACTGGCCTCCAGTTCTTCGGTTATTCTATTGCTCTACTGGGTCTTGTTTGG
TACAAGCTTGGCGGCGACAAGATGCGCGAGTACACTTCGTCTGCCGGCCGTGCCTGGGCTGACTATGGCAACAAC
CGCCCTGCGCAGCGCAAATTTGTCGTCTTTGGTGCTGCCGCTCTTATTTTCTTCCTCTTCGTTGGCTCTATGGCT
CCCAGCTACGCCAATGACTCTGTTGACCGTGTCAAGGGCTACCTTGGCGGTGCTACTGCTGGTAATGCTTAA
Transcript >Pro_DTO377G3_2|g2742.t1
ATGAGCGACGGCGAGAAGGTCCGCGCCTCTGGCGAGACTCCCCGGGAGCAGTCTTTGCCTACTGTCAACCCCGCA
GCGGAGAAGACAGAGCAGCCGGGCATTACATTCCACCCCGCGGTCTATGTGACTACATGGATCACCTTGAGTTCC
ACTGTTATCCTGTTCAACAAGTACCTCCTCGACTATGCCAACTTCCGTTTCCCCATCATCCTCACAACATGGCAT
CTGTCTTTCGCTACTGTCATGACCCAAATCCTCGCTCGCACCACTACTGTCCTCGATGGCCGCAAGAAGGTCAAG
ATGACCGGCCGTGTCTACCTCCGCGCTATCGTCCCTATCGGTATAATGTTCAGTCTGAGCTTGATTTGCGGTAAC
ATGACCTACCTCTACCTGAGCGTTGCCTTTATCCAAATGCTCAAGGCCACCACCCCTGTGGCTGTTCTCCTCGCA
ACCTGGGGTATGGGCATGGCTCCGGCCAACATGAAGGTCCTGGCCAACGTCTCCATCATCGTGATCGGTGTGATC
ATTGCCTCCTTCGGTGAGATCAAGTTCAACATGGTCGGTTTCCTGTTCCAGCTCGGTGGTATCGTTTTCGAGGCC
ACCCGTCTGGTCATGGTACAGGGTCTGCTTAGCTCCGCCGACTTTAAGATGGACCCCATGGTTTCTCTGTACTAC
TTCGCCCCCATCTGTGCCGTCATGAACGGTGTCGTTGCTCTGTTCTTGGAATTCCCCCATGTCACCATGGACCAT
GTCTACTCCGTTGGTATCTGGCTTCTAGTTCTCAATGCCGTTGTGGCTTTCCTGCTCAACGTCTCGGTCGTTTTC
CTGATTGGCAAGACCTCTTCCCTGGTCATGACTCTGTGCGGTGTCCTCAAGGATATCCTATTGGTTGCTGCCTCC
ATGTTCCTGTGGCAGACTCCCGTCACTGGCCTCCAGTTCTTCGGTTATTCTATTGCTCTACTGGGTCTTGTTTGG
TACAAGCTTGGCGGCGACAAGATGCGCGAGTACACTTCGTCTGCCGGCCGTGCCTGGGCTGACTATGGCAACAAC
CGCCCTGCGCAGCGCAAATTTGTCGTCTTTGGTGCTGCCGCTCTTATTTTCTTCCTCTTCGTTGGCTCTATGGCT
CCCAGCTACGCCAATGACTCTGTTGACCGTGTCAAGGGCTACCTTGGCGGTGCTACTGCTGGTAATGCTTAA
Gene >Pro_DTO377G3_2|g2742.t1
ATGAGCGACGGCGAGAAGGTCCGCGCCTCTGGCGAGACTCCCCGGGAGCAGTCTTTGCCTACTGTCAACCCCGCA
GCGGAGAAGACAGAGCAGCCGGGCATTACATTCCACCCCGCGGTCTATGTGACGTGAGCAACATCGGAAGGAACC
AGACAGATCGGAGAACATTGCTGATATTTTGATAGTACATGGATCACCTTGAGTTCCACTGTTATCCTGTTCAAC
AAGTACCTCCTCGACTATGCCAACTTCCGTAAGTCAGACCGGAGATACAATGCGAGGAAACTGGCACTAACCTCA
CGCTGTGAATAGGTTTCCCCATCATCCTCACAACATGGCATCTGTCTTTCGCTACTGTCATGACCCAAATCCTCG
CTCGCACCACTACTGTCCTCGATGGCCGCAAGAAGGTCAAGATGACCGGCCGTGTCTACCTCCGCGCTATCGTCC
CTATCGGTATAATGTTCAGTCTGAGCTTGATTTGCGGTAACATGACCTACCTCTACCTGAGCGTTGCCTTTATCC
AAATGCTCAAGGCCACCACCCCTGTGGCTGTTCTCCTCGCAACCTGGGGTATGGGCATGGCTCCGGCCAACATGA
AGGTCCTGGCCAACGTCTCCATCATCGTGATCGGTGTGATCATTGCCTCCTTCGGTGAGATCAAGTTCAACATGG
TCGGTTTCCTGTTCCAGCTCGGTGGTATCGTTTTCGAGGCCACCCGTCTGGTCATGGTACAGGGTCTGCTTAGCT
CCGCCGACTTTAAGATGGACCCCATGGTTTCTCTGTACTACTTCGCCCCCATCTGTGCCGTCATGAACGGTGTCG
TTGCTCTGTTCTTGGAATTCCCCCATGTCACCATGGACCATGTCTACTCCGTTGGTATCTGGCTTCTAGTTCTCA
ATGCCGTTGTGGCTTTCCTGCTCAACGTCTCGGTCGTTTTCCTGGTAAGTGATACTTTAGCAACCCGCATCTTAC
TCCCGAGGGAAGCGTTACTAATACTCTCTACAGATTGGCAAGACCTCTTCCCTGGTCATGACTCTGTGCGGTGTC
CTCAAGGATATCCTATTGGTTGCTGCCTCCATGTTCCTGTGGCAGACTCCCGTCACTGGCCTCCAGTTCTTCGGT
TATTCTATTGCTCTACTGGGTCTTGTTTGGTACAAGCTTGGCGGCGACAAGATGCGCGAGTACACTTCGTCTGCC
GGCCGTGCCTGGGCTGACTATGGCAACAACCGCCCTGCGCAGCGCAAATTTGTCGTCTTTGGTGCTGCCGCTCTT
ATTTTCTTCCTCTTCGTTGGCTCTATGGCTCCCAGCTACGCCAATGACTCTGTTGACCGTGTCAAGGGCTACCTT
GGCGGTGCTACTGCTGGTAATGCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail