Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2722.t1
Gene name
Locationscaffold_03:776043..779994
Strand+
Gene length (bp)3951
Transcript length (bp)3729
Coding sequence length (bp)3729
Protein length (aa) 1243

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13236 CLU Clustered mitochondria 6.8E-75 344 566
PF12807 eIF3_p135 Translation initiation factor eIF3 subunit 135 2.6E-53 690 852
PF13424 TPR_12 Tetratricopeptide repeat 1.9E-12 1050 1122
PF15044 CLU_N Mitochondrial function, CLU-N-term 1.3E-24 59 131
PF13374 TPR_10 Tetratricopeptide repeat 3.5E-05 966 1006
PF13374 TPR_10 Tetratricopeptide repeat 4.4E-04 1008 1048
PF13374 TPR_10 Tetratricopeptide repeat 3.7E-06 1051 1088

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2722.t1
MAETNGELEHSKEAPQASQEITNGNAPEGTEEDNTGGLFQITVKLPHAPHKIQVMVSSQEQVQDVRQSIVELPGT
FQYTCFHLEFNGNRINDFVELSEVPDLEADSEIVLVEDPYTEKEARMHIVRIRELIGASGDRVDNLHGISAGLSL
HDAITADAIKAGESDKEHSLSKYDLTGPSPLQTILPIAEAPLPKTVKSISLSAWNPVPYNLRQKGHLLYLVVSTN
EGEQFQITAHVSGFFVNKCSSVRFDPSPKPTHPKKGSAHSLLTLISQLSPSFDASFEALQEYNNEKDLLTTFPFQ
NAIPNSPWLIAPSSSSLNAHQPDITRSQENYLISGVDNAETLRDWNEEFQTTRELPRETVQDRVFRERLTSKLFA
DYNEAAARGAVLVARGEVAPLNPTEARDAQIFVYNNIFYSFGADGVGTFTSEGGDEAARVAVGKDVLGIKAVNQL
DIDGLFTPGTVVVDYLGKRIVGQSIVPGIFKQREPGEHQIDYGGVEGKEVVATHADFIPVFEKLSKALRVKQHPV
WDKENKRHELEGSVETKGLLGTDGRKYVLDLYRVAPLDVEWQEEDGSDVYPHRMSVLRLELVESYWRHKMSQYVK
AQVESRKAAAAEAAKEGKPEEENAEQDRVDISDFHLALNPDVFSGQVPQTEEEKKQWAKDEQEVRDACDHLRSKV
IPDLLKDLHDGDVGFPMDGQSLTQLLHKRGINLRYLGTLAKQSAEKGPRLQALSILVVQEMVTRAFKHVANRYLN
NVPAPFVAPCLAHLLNCLLGSDVNATPKAEIDESLRAIFPEGDFSFENVTPESLRAEIEKQVTIRFRFSLEKDWS
NSLRYLQLLRDISIKLGIQLGARDFAFTKDQVKEQVVVPITNGSTHEEPKKKGKKKGGDNKSPTRAAPAPAKPAV
TFTADDILNVVPLVRDASPRSALAEEALEAGRISLMQNQKQLGQELILESLSLHEQIYGILHPEVAKLYHQLSML
YYQTDEKEAAVELARKAVIVTERTMGVDSADTILSYLNLSLFEHASGNTKTALVYIKHAMDVWKIIYGPNHPDSI
TTMNNAAVMLQHLKQYNDSRKWFEASLSVCEDLFGKDSINTATILFQLAQALALDQDSKAAVGKMREAYNIFLTQ
LGPEDRNTKEAENWLEQLTQNAVSIAKHAKDIQARRLRRNPLNPRVSSMGTRVQPQVGQSAPEISTPTDPSALDS
RSIDELLKFIEGSDATSSRSKQKKRAATSNPKLRGSKQSNKA*
Coding >Pro_DTO377G3_2|g2722.t1
ATGGCAGAGACCAATGGGGAGTTGGAGCACTCGAAAGAGGCTCCTCAAGCTTCCCAAGAGATTACCAATGGCAAT
GCCCCCGAGGGCACAGAGGAGGACAACACCGGTGGTCTTTTCCAGATCACCGTGAAGCTCCCTCATGCGCCTCAT
AAGATTCAAGTGATGGTCTCCAGCCAAGAACAGGTCCAGGATGTCCGCCAATCCATTGTCGAGTTACCGGGAACC
TTCCAATACACTTGCTTCCACCTCGAGTTCAACGGCAACCGCATCAACGACTTTGTTGAGCTGTCTGAGGTCCCA
GACCTCGAGGCCGACTCCGAGATCGTCCTGGTCGAAGATCCCTACACCGAAAAGGAAGCCCGCATGCATATTGTG
CGGATCAGGGAGCTAATTGGTGCTTCTGGTGACCGTGTTGATAACCTCCATGGTATCTCCGCTGGCCTGTCCTTG
CACGATGCTATCACGGCAGACGCTATCAAGGCCGGCGAGTCGGACAAGGAACACTCGCTCTCCAAATATGACCTC
ACTGGACCTTCACCGCTGCAAACTATCCTGCCCATCGCAGAGGCTCCTCTGCCAAAGACAGTGAAGTCTATCTCG
TTGTCTGCATGGAACCCTGTTCCGTACAACCTCCGCCAGAAAGGCCACTTGCTTTACCTCGTGGTTTCTACTAAC
GAAGGTGAACAATTCCAGATCACTGCCCATGTGTCTGGTTTCTTCGTGAACAAGTGCTCGAGCGTCAGATTCGAC
CCATCCCCGAAGCCAACACACCCCAAGAAGGGCAGCGCCCACTCCTTGCTCACTCTCATCTCTCAACTCTCGCCC
TCGTTCGACGCCTCCTTCGAGGCCCTGCAGGAGTACAACAATGAGAAGGATCTTTTGACCACTTTCCCCTTCCAG
AACGCCATCCCCAACAGCCCATGGCTCATCGCCCCCAGCAGTTCAAGCTTGAATGCTCACCAGCCCGATATCACC
CGTTCGCAGGAGAACTACCTGATCTCTGGTGTTGATAATGCCGAGACTCTGCGTGACTGGAACGAGGAGTTCCAG
ACTACCCGCGAGCTGCCCCGCGAGACCGTTCAGGATCGCGTGTTCCGGGAACGTTTGACTTCCAAGCTGTTCGCT
GATTATAACGAGGCCGCCGCTCGTGGTGCAGTCCTTGTTGCCCGGGGTGAGGTTGCTCCTCTGAACCCCACTGAG
GCGCGGGACGCCCAGATCTTTGTCTACAACAACATCTTCTACTCTTTCGGTGCCGATGGCGTTGGAACTTTCACC
TCCGAGGGTGGCGACGAAGCCGCACGTGTGGCTGTGGGCAAGGATGTTCTCGGTATCAAGGCCGTTAACCAGCTT
GATATCGACGGACTGTTCACTCCCGGAACCGTGGTGGTCGACTACCTGGGCAAGCGTATTGTTGGCCAGAGCATT
GTTCCTGGTATCTTCAAGCAGCGCGAGCCCGGTGAGCACCAGATTGACTACGGTGGTGTTGAGGGCAAGGAGGTT
GTGGCTACTCACGCTGACTTTATCCCGGTCTTCGAGAAGCTCTCGAAGGCGCTGCGTGTCAAGCAGCACCCTGTC
TGGGACAAGGAAAACAAGCGCCACGAGTTGGAAGGTAGCGTCGAGACTAAGGGACTCTTGGGCACTGACGGCAGG
AAGTACGTCCTGGATCTCTACCGCGTGGCTCCTCTGGATGTCGAGTGGCAGGAAGAAGATGGAAGCGATGTTTAC
CCCCACCGCATGTCCGTTCTCAGACTTGAGTTGGTCGAGTCCTACTGGCGCCACAAGATGAGCCAGTACGTGAAG
GCCCAGGTGGAGAGTCGTAAGGCTGCTGCCGCCGAGGCTGCCAAGGAGGGCAAGCCTGAGGAGGAGAATGCGGAG
CAGGATCGTGTTGACATCTCTGATTTCCACCTTGCTCTCAACCCCGATGTTTTCAGCGGCCAGGTGCCCCAGACT
GAGGAGGAGAAGAAGCAATGGGCAAAGGATGAGCAAGAAGTCCGGGATGCCTGTGATCACTTGCGATCCAAGGTC
ATCCCCGACCTGCTCAAGGACCTGCACGACGGCGACGTCGGCTTCCCCATGGACGGTCAATCGCTGACCCAGCTG
TTGCACAAGCGTGGTATCAACCTCCGTTACCTCGGAACGTTGGCCAAGCAATCCGCCGAGAAGGGACCTCGCCTG
CAGGCCCTGTCCATCCTCGTGGTTCAGGAAATGGTTACTCGTGCCTTCAAGCACGTTGCCAACCGCTACCTGAAC
AACGTTCCCGCCCCCTTCGTCGCCCCTTGCCTTGCTCACCTGCTGAACTGTCTCCTCGGTTCAGATGTCAACGCT
ACTCCCAAGGCGGAGATTGACGAATCCCTGCGTGCGATCTTCCCCGAGGGCGATTTCTCTTTTGAGAATGTCACT
CCCGAGTCCCTCCGGGCCGAAATCGAGAAGCAGGTCACCATCCGCTTCCGCTTCTCCCTTGAGAAGGACTGGAGC
AACTCCCTGAGATACTTGCAGCTTCTGCGTGATATCTCTATCAAGTTGGGTATCCAGCTTGGTGCCCGTGATTTC
GCCTTCACCAAGGATCAGGTCAAGGAGCAGGTTGTTGTTCCTATCACTAACGGATCCACACACGAGGAGCCTAAG
AAGAAGGGCAAGAAGAAGGGTGGAGACAACAAGTCCCCTACCCGTGCCGCTCCAGCGCCAGCTAAGCCCGCTGTC
ACTTTCACTGCTGATGACATCCTGAATGTTGTTCCTTTGGTCCGTGATGCCTCTCCTCGCAGCGCATTGGCAGAG
GAGGCCCTGGAGGCCGGCCGTATCTCTCTCATGCAGAACCAGAAGCAGTTGGGCCAGGAGCTCATCCTTGAGTCT
TTGTCTCTGCACGAGCAAATTTACGGTATCCTGCATCCTGAGGTCGCCAAGCTCTACCACCAGCTTTCCATGCTG
TACTACCAGACTGATGAGAAGGAGGCTGCTGTGGAATTGGCCCGCAAGGCCGTCATTGTCACTGAACGCACTATG
GGTGTCGATTCAGCTGACACTATTCTGAGCTACCTTAACCTGAGTCTATTCGAGCACGCCTCTGGTAACACCAAG
ACCGCTCTGGTTTACATCAAGCATGCTATGGATGTATGGAAGATCATCTACGGTCCTAACCACCCCGACTCCATC
ACCACAATGAACAACGCCGCCGTGATGCTGCAACACCTCAAGCAGTACAACGACTCCCGCAAGTGGTTCGAGGCC
TCTCTCTCCGTCTGTGAGGACCTCTTTGGCAAGGACTCTATCAATACCGCCACTATTCTCTTCCAACTCGCCCAG
GCACTCGCTTTGGACCAGGACTCCAAGGCTGCCGTCGGCAAGATGCGCGAGGCATACAACATCTTCCTCACTCAG
CTTGGACCCGAAGATCGCAACACCAAGGAGGCCGAGAACTGGCTCGAGCAGCTCACTCAGAACGCTGTCTCTATC
GCCAAGCACGCCAAGGACATCCAGGCTCGTCGTCTGCGCCGCAACCCTCTGAACCCTCGTGTGTCTTCCATGGGA
ACCCGTGTTCAGCCCCAGGTTGGCCAGTCTGCGCCCGAAATCAGTACTCCCACCGATCCTTCGGCTCTCGACTCT
CGCAGCATCGACGAGCTTCTGAAGTTCATTGAAGGTAGCGACGCCACCTCTTCGCGCTCCAAGCAGAAGAAGCGT
GCAGCCACCAGCAACCCTAAGCTTCGCGGCTCCAAGCAGTCTAACAAGGCATAA
Transcript >Pro_DTO377G3_2|g2722.t1
ATGGCAGAGACCAATGGGGAGTTGGAGCACTCGAAAGAGGCTCCTCAAGCTTCCCAAGAGATTACCAATGGCAAT
GCCCCCGAGGGCACAGAGGAGGACAACACCGGTGGTCTTTTCCAGATCACCGTGAAGCTCCCTCATGCGCCTCAT
AAGATTCAAGTGATGGTCTCCAGCCAAGAACAGGTCCAGGATGTCCGCCAATCCATTGTCGAGTTACCGGGAACC
TTCCAATACACTTGCTTCCACCTCGAGTTCAACGGCAACCGCATCAACGACTTTGTTGAGCTGTCTGAGGTCCCA
GACCTCGAGGCCGACTCCGAGATCGTCCTGGTCGAAGATCCCTACACCGAAAAGGAAGCCCGCATGCATATTGTG
CGGATCAGGGAGCTAATTGGTGCTTCTGGTGACCGTGTTGATAACCTCCATGGTATCTCCGCTGGCCTGTCCTTG
CACGATGCTATCACGGCAGACGCTATCAAGGCCGGCGAGTCGGACAAGGAACACTCGCTCTCCAAATATGACCTC
ACTGGACCTTCACCGCTGCAAACTATCCTGCCCATCGCAGAGGCTCCTCTGCCAAAGACAGTGAAGTCTATCTCG
TTGTCTGCATGGAACCCTGTTCCGTACAACCTCCGCCAGAAAGGCCACTTGCTTTACCTCGTGGTTTCTACTAAC
GAAGGTGAACAATTCCAGATCACTGCCCATGTGTCTGGTTTCTTCGTGAACAAGTGCTCGAGCGTCAGATTCGAC
CCATCCCCGAAGCCAACACACCCCAAGAAGGGCAGCGCCCACTCCTTGCTCACTCTCATCTCTCAACTCTCGCCC
TCGTTCGACGCCTCCTTCGAGGCCCTGCAGGAGTACAACAATGAGAAGGATCTTTTGACCACTTTCCCCTTCCAG
AACGCCATCCCCAACAGCCCATGGCTCATCGCCCCCAGCAGTTCAAGCTTGAATGCTCACCAGCCCGATATCACC
CGTTCGCAGGAGAACTACCTGATCTCTGGTGTTGATAATGCCGAGACTCTGCGTGACTGGAACGAGGAGTTCCAG
ACTACCCGCGAGCTGCCCCGCGAGACCGTTCAGGATCGCGTGTTCCGGGAACGTTTGACTTCCAAGCTGTTCGCT
GATTATAACGAGGCCGCCGCTCGTGGTGCAGTCCTTGTTGCCCGGGGTGAGGTTGCTCCTCTGAACCCCACTGAG
GCGCGGGACGCCCAGATCTTTGTCTACAACAACATCTTCTACTCTTTCGGTGCCGATGGCGTTGGAACTTTCACC
TCCGAGGGTGGCGACGAAGCCGCACGTGTGGCTGTGGGCAAGGATGTTCTCGGTATCAAGGCCGTTAACCAGCTT
GATATCGACGGACTGTTCACTCCCGGAACCGTGGTGGTCGACTACCTGGGCAAGCGTATTGTTGGCCAGAGCATT
GTTCCTGGTATCTTCAAGCAGCGCGAGCCCGGTGAGCACCAGATTGACTACGGTGGTGTTGAGGGCAAGGAGGTT
GTGGCTACTCACGCTGACTTTATCCCGGTCTTCGAGAAGCTCTCGAAGGCGCTGCGTGTCAAGCAGCACCCTGTC
TGGGACAAGGAAAACAAGCGCCACGAGTTGGAAGGTAGCGTCGAGACTAAGGGACTCTTGGGCACTGACGGCAGG
AAGTACGTCCTGGATCTCTACCGCGTGGCTCCTCTGGATGTCGAGTGGCAGGAAGAAGATGGAAGCGATGTTTAC
CCCCACCGCATGTCCGTTCTCAGACTTGAGTTGGTCGAGTCCTACTGGCGCCACAAGATGAGCCAGTACGTGAAG
GCCCAGGTGGAGAGTCGTAAGGCTGCTGCCGCCGAGGCTGCCAAGGAGGGCAAGCCTGAGGAGGAGAATGCGGAG
CAGGATCGTGTTGACATCTCTGATTTCCACCTTGCTCTCAACCCCGATGTTTTCAGCGGCCAGGTGCCCCAGACT
GAGGAGGAGAAGAAGCAATGGGCAAAGGATGAGCAAGAAGTCCGGGATGCCTGTGATCACTTGCGATCCAAGGTC
ATCCCCGACCTGCTCAAGGACCTGCACGACGGCGACGTCGGCTTCCCCATGGACGGTCAATCGCTGACCCAGCTG
TTGCACAAGCGTGGTATCAACCTCCGTTACCTCGGAACGTTGGCCAAGCAATCCGCCGAGAAGGGACCTCGCCTG
CAGGCCCTGTCCATCCTCGTGGTTCAGGAAATGGTTACTCGTGCCTTCAAGCACGTTGCCAACCGCTACCTGAAC
AACGTTCCCGCCCCCTTCGTCGCCCCTTGCCTTGCTCACCTGCTGAACTGTCTCCTCGGTTCAGATGTCAACGCT
ACTCCCAAGGCGGAGATTGACGAATCCCTGCGTGCGATCTTCCCCGAGGGCGATTTCTCTTTTGAGAATGTCACT
CCCGAGTCCCTCCGGGCCGAAATCGAGAAGCAGGTCACCATCCGCTTCCGCTTCTCCCTTGAGAAGGACTGGAGC
AACTCCCTGAGATACTTGCAGCTTCTGCGTGATATCTCTATCAAGTTGGGTATCCAGCTTGGTGCCCGTGATTTC
GCCTTCACCAAGGATCAGGTCAAGGAGCAGGTTGTTGTTCCTATCACTAACGGATCCACACACGAGGAGCCTAAG
AAGAAGGGCAAGAAGAAGGGTGGAGACAACAAGTCCCCTACCCGTGCCGCTCCAGCGCCAGCTAAGCCCGCTGTC
ACTTTCACTGCTGATGACATCCTGAATGTTGTTCCTTTGGTCCGTGATGCCTCTCCTCGCAGCGCATTGGCAGAG
GAGGCCCTGGAGGCCGGCCGTATCTCTCTCATGCAGAACCAGAAGCAGTTGGGCCAGGAGCTCATCCTTGAGTCT
TTGTCTCTGCACGAGCAAATTTACGGTATCCTGCATCCTGAGGTCGCCAAGCTCTACCACCAGCTTTCCATGCTG
TACTACCAGACTGATGAGAAGGAGGCTGCTGTGGAATTGGCCCGCAAGGCCGTCATTGTCACTGAACGCACTATG
GGTGTCGATTCAGCTGACACTATTCTGAGCTACCTTAACCTGAGTCTATTCGAGCACGCCTCTGGTAACACCAAG
ACCGCTCTGGTTTACATCAAGCATGCTATGGATGTATGGAAGATCATCTACGGTCCTAACCACCCCGACTCCATC
ACCACAATGAACAACGCCGCCGTGATGCTGCAACACCTCAAGCAGTACAACGACTCCCGCAAGTGGTTCGAGGCC
TCTCTCTCCGTCTGTGAGGACCTCTTTGGCAAGGACTCTATCAATACCGCCACTATTCTCTTCCAACTCGCCCAG
GCACTCGCTTTGGACCAGGACTCCAAGGCTGCCGTCGGCAAGATGCGCGAGGCATACAACATCTTCCTCACTCAG
CTTGGACCCGAAGATCGCAACACCAAGGAGGCCGAGAACTGGCTCGAGCAGCTCACTCAGAACGCTGTCTCTATC
GCCAAGCACGCCAAGGACATCCAGGCTCGTCGTCTGCGCCGCAACCCTCTGAACCCTCGTGTGTCTTCCATGGGA
ACCCGTGTTCAGCCCCAGGTTGGCCAGTCTGCGCCCGAAATCAGTACTCCCACCGATCCTTCGGCTCTCGACTCT
CGCAGCATCGACGAGCTTCTGAAGTTCATTGAAGGTAGCGACGCCACCTCTTCGCGCTCCAAGCAGAAGAAGCGT
GCAGCCACCAGCAACCCTAAGCTTCGCGGCTCCAAGCAGTCTAACAAGGCATAA
Gene >Pro_DTO377G3_2|g2722.t1
ATGGCAGAGACCAATGGGGAGTTGGAGCACTCGAAAGGTGTGTGTTCCTTGGAACCTCCGTGCTGGACAAGGTCT
ATTAGAATACAGCATGGGCTCCGGGTAAAACAAGATGCAGGGCACACAAGCTAACGGAGGAACAGAGGCTCCTCA
AGCTTCCCAAGAGATTACCAATGGCAATGCCCCCGAGGGCACAGAGGAGGACAACACCGGTGGTATGTTTTGTAG
ACAGGCGCAAAACTGTGTAGCGGCGTTCTAACCCGACTATAGGTCTTTTCCAGATCACCGTGAAGCTCCCTCATG
CGCCTCATAAGATTCAAGTGATGGTGGGTTCGATGTTTGGAAAAGCCACAAATAGCGAAAATTTATCTGACCTGT
TTATTCCTCTAGGTCTCCAGCCAAGAACAGGTCCAGGATGTCCGCCAATCCATTGTCGAGTTACCGGGAACCTTC
CAATACACTTGCTTCCACCTCGAGTTCAACGGCAACCGCATCAACGACTTTGTTGAGCTGTCTGAGGTCCCAGAC
CTCGAGGCCGACTCCGAGATCGTCCTGGTCGAAGATCCCTACACCGAAAAGGAAGCCCGCATGCATATTGTGCGG
ATCAGGGAGCTAATTGGTGCTTCTGGTGACCGTGTTGATAACCTCCATGGTATCTCCGCTGGCCTGTCCTTGCAC
GATGCTATCACGGCAGACGCTATCAAGGCCGGCGAGTCGGACAAGGAACACTCGCTCTCCAAATATGACCTCACT
GGACCTTCACCGCTGCAAACTATCCTGCCCATCGCAGAGGCTCCTCTGCCAAAGACAGTGAAGTCTATCTCGTTG
TCTGCATGGAACCCTGTTCCGTACAACCTCCGCCAGAAAGGCCACTTGCTTTACCTCGTGGTTTCTACTAACGAA
GGTGAACAATTCCAGATCACTGCCCATGTGTCTGGTTTCTTCGTGAACAAGTGCTCGAGCGTCAGATTCGACCCA
TCCCCGAAGCCAACACACCCCAAGAAGGGCAGCGCCCACTCCTTGCTCACTCTCATCTCTCAACTCTCGCCCTCG
TTCGACGCCTCCTTCGAGGCCCTGCAGGAGTACAACAATGAGAAGGATCTTTTGACCACTTTCCCCTTCCAGAAC
GCCATCCCCAACAGCCCATGGCTCATCGCCCCCAGCAGTTCAAGCTTGAATGCTCACCAGCCCGATATCACCCGT
TCGCAGGAGAACTACCTGATCTCTGGTGTTGATAATGCCGAGACTCTGCGTGACTGGAACGAGGAGTTCCAGACT
ACCCGCGAGCTGCCCCGCGAGACCGTTCAGGATCGCGTGTTCCGGGAACGTTTGACTTCCAAGCTGTTCGCTGAT
TATAACGAGGCCGCCGCTCGTGGTGCAGTCCTTGTTGCCCGGGGTGAGGTTGCTCCTCTGAACCCCACTGAGGCG
CGGGACGCCCAGATCTTTGTCTACAACAACATCTTCTACTCTTTCGGTGCCGATGGCGTTGGAACTTTCACCTCC
GAGGGTGGCGACGAAGCCGCACGTGTGGCTGTGGGCAAGGATGTTCTCGGTATCAAGGCCGTTAACCAGCTTGAT
ATCGACGGACTGTTCACTCCCGGAACCGTGGTGGTCGACTACCTGGGCAAGCGTATTGTTGGCCAGAGCATTGTT
CCTGGTATCTTCAAGCAGCGCGAGCCCGGTGAGCACCAGATTGACTACGGTGGTGTTGAGGGCAAGGAGGTTGTG
GCTACTCACGCTGACTTTATCCCGGTCTTCGAGAAGCTCTCGAAGGCGCTGCGTGTCAAGCAGCACCCTGTCTGG
GACAAGGAAAACAAGCGCCACGAGTTGGAAGGTAGCGTCGAGACTAAGGGACTCTTGGGCACTGACGGCAGGAAG
TACGTCCTGGATCTCTACCGCGTGGCTCCTCTGGATGTCGAGTGGCAGGAAGAAGATGGAAGCGATGTTTACCCC
CACCGCATGTCCGTTCTCAGACTTGAGTTGGTCGAGTCCTACTGGCGCCACAAGATGAGCCAGTACGTGAAGGCC
CAGGTGGAGAGTCGTAAGGCTGCTGCCGCCGAGGCTGCCAAGGAGGGCAAGCCTGAGGAGGAGAATGCGGAGCAG
GATCGTGTTGACATCTCTGATTTCCACCTTGCTCTCAACCCCGATGTTTTCAGCGGCCAGGTGCCCCAGACTGAG
GAGGAGAAGAAGCAATGGGCAAAGGATGAGCAAGAAGTCCGGGATGCCTGTGATCACTTGCGATCCAAGGTCATC
CCCGACCTGCTCAAGGACCTGCACGACGGCGACGTCGGCTTCCCCATGGACGGTCAATCGCTGACCCAGCTGTTG
CACAAGCGTGGTATCAACCTCCGTTACCTCGGAACGTTGGCCAAGCAATCCGCCGAGAAGGGACCTCGCCTGCAG
GCCCTGTCCATCCTCGTGGTTCAGGAAATGGTTACTCGTGCCTTCAAGCACGTTGCCAACCGCTACCTGAACAAC
GTTCCCGCCCCCTTCGTCGCCCCTTGCCTTGCTCACCTGCTGAACTGTCTCCTCGGTTCAGATGTCAACGCTACT
CCCAAGGCGGAGATTGACGAATCCCTGCGTGCGATCTTCCCCGAGGGCGATTTCTCTTTTGAGAATGTCACTCCC
GAGTCCCTCCGGGCCGAAATCGAGAAGCAGGTCACCATCCGCTTCCGCTTCTCCCTTGAGAAGGACTGGAGCAAC
TCCCTGAGATACTTGCAGCTTCTGCGTGATATCTCTATCAAGTTGGGTATCCAGCTTGGTGCCCGTGATTTCGCC
TTCACCAAGGATCAGGTCAAGGAGCAGGTTGTTGTTCCTATCACTAACGGATCCACACACGAGGAGCCTAAGAAG
AAGGGCAAGAAGAAGGGTGGAGACAACAAGTCCCCTACCCGTGCCGCTCCAGCGCCAGCTAAGCCCGCTGTCACT
TTCACTGCTGATGACATCCTGAATGTTGTTCCTTTGGTCCGTGATGCCTCTCCTCGCAGCGCATTGGCAGAGGAG
GCCCTGGAGGCCGGCCGTATCTCTCTCATGCAGAACCAGAAGCAGTTGGGCCAGGAGCTCATCCTTGAGTCTTTG
TCTCTGCACGAGCAAATTTACGGTATCCTGCATCCTGAGGTCGCCAAGCTCTACCACCAGCTTTCCATGCTGTAC
TACCAGACTGATGAGAAGGAGGCTGCTGTGGAATTGGCCCGCAAGGCCGTCATTGTCACTGAACGCACTATGGGT
GTCGATTCAGCTGACACTATTCTGAGCTACCTTAACCTGAGTCTATTCGAGCACGCCTCTGGTAACACCAAGACC
GCTCTGGTTTACATCAAGCATGCTATGGATGTATGGAAGATCATCTACGGTCCTAACCACCCCGACTCCATCACC
ACAATGAACAACGCCGCCGTGATGCTGCAACACCTCAAGCAGTACAACGACTCCCGCAAGTGGTTCGAGGCCTCT
CTCTCCGTCTGTGAGGACCTCTTTGGCAAGGACTCTATCAATACCGCCACTATTCTCTTCCAACTCGCCCAGGCA
CTCGCTTTGGACCAGGACTCCAAGGCTGCCGTCGGCAAGATGCGCGAGGCATACAACATCTTCCTCACTCAGCTT
GGACCCGAAGATCGCAACACCAAGGAGGCCGAGAACTGGCTCGAGCAGCTCACTCAGAACGCTGTCTCTATCGCC
AAGCACGCCAAGGACATCCAGGCTCGTCGTCTGCGCCGCAACCCTCTGAACCCTCGTGTGTCTTCCATGGGAACC
CGTGTTCAGCCCCAGGTTGGCCAGTCTGCGCCCGAAATCAGTACTCCCACCGATCCTTCGGCTCTCGACTCTCGC
AGCATCGACGAGCTTCTGAAGTTCATTGAAGGTAGCGACGCCACCTCTTCGCGCTCCAAGCAGAAGAAGCGTGCA
GCCACCAGCAACCCTAAGCTTCGCGGCTCCAAGCAGTCTAACAAGGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail