Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2717.t1
Gene name
Locationscaffold_03:764572..767359
Strand+
Gene length (bp)2787
Transcript length (bp)2460
Coding sequence length (bp)2460
Protein length (aa) 820

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09364 XFP_N XFP N-terminal domain 1.2E-151 34 394
PF09363 XFP_C XFP C-terminal domain 2.3E-78 599 802
PF03894 XFP D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase 5.9E-75 418 588

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0016832 aldehyde-lyase activity Yes
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0016829 lyase activity No
GO:0016830 carbon-carbon lyase activity No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2717.t1
MPAEIIDQPNPAALPSYLPDYLEKLSVKLDHEKLDEKACDALLKFRRAACYIAAAMIFLQENTLLKSELTPHDIK
PRLLGHWGTCPGLILVYSHLNYLIRTRNLDMLYVVGPGHGAPAILAALWLEGSLERFYPEYSRDSKGLHKLISSF
STTAGFPSHINAETPGAIHEGGELGYALAVSFGAVMDNPDLIVPCIVGDGEAETGATATSWHAIKYIDPKESGAV
LPILHLNGFKISERTIFGCMDHKELVALFSGYGYQVRFVEDLNNIDADLHFSMTWAIEEIQRIQKAARSGKPIMK
PRWPMLILRTPKGWSGPKEVHGMFLEGSFHSHQVPLPKAKTDKEQLDLLQKWLSSYKPDELFTSTGDVIDEIKSV
IPTEDKKKLGQRIEAYNGYKRPNLPDWRPFCVEKGSDASAMKVIGSFINQTFKDNPTNVRLFSPDELESNKLDEV
FEGTNRNFQWDQFSNARGGRVIEILSEHMCQGFLQGYTLTGRIGIFPSYESFLGIIHTMMVQYAKFTKMALETTW
HTSVSSINYIESSTWTRQEHNGFSHQNPSFIGSVLKLKPTAARVYLPPDANTFLTTVHHCLKSRNYVNLMVGSKQ
PTPVYLTPKEAESHCRAGASIWKFCSTDEGINPDVVLVGIGVEVMFEVIAAAALLRKLIPELRVCVINVTDLMIL
ENQGLHPHALSTEAFDSLFTADKPIHFNYHGYPTELQGLLFGRPRLERVTVAGYIEEGSTTTPFDMMLLNRVSRY
HVAQHAIHGAAKGNEKIRVYQQELNAQLEGSIVNTRRYIVANRDDPPGIYDTPQFHNFHKPAEPFWDLE*
Coding >Pro_DTO377G3_2|g2717.t1
ATGCCTGCAGAAATTATAGACCAACCAAATCCAGCTGCGCTGCCGTCGTATCTACCAGATTATCTTGAGAAACTG
AGCGTCAAGTTGGATCATGAGAAACTAGATGAAAAAGCTTGTGATGCCTTGCTCAAGTTTCGCCGAGCGGCTTGT
TACATTGCGGCAGCTATGATATTTTTGCAAGAAAATACTCTTTTAAAGTCGGAACTCACACCTCACGACATCAAA
CCTCGACTACTCGGTCATTGGGGAACATGTCCGGGCCTAATTTTGGTCTACTCTCATCTGAACTACCTGATCCGG
ACAAGGAACCTGGACATGCTGTACGTTGTCGGCCCAGGACATGGTGCACCAGCAATCCTAGCCGCACTATGGCTA
GAGGGCTCGCTGGAGAGATTTTATCCCGAATATTCGCGAGACAGCAAAGGCCTGCACAAACTGATCTCGAGCTTT
AGCACAACAGCTGGCTTTCCTAGCCACATCAATGCTGAAACCCCTGGTGCTATCCATGAAGGTGGAGAACTGGGA
TACGCTCTAGCAGTGTCCTTTGGCGCTGTCATGGACAACCCCGATCTGATAGTGCCTTGTATCGTGGGTGACGGA
GAGGCTGAAACCGGTGCCACCGCCACGTCCTGGCATGCAATCAAGTACATTGATCCCAAGGAATCTGGTGCAGTT
TTGCCAATTCTGCATCTGAATGGTTTCAAAATCAGCGAGCGCACAATATTTGGGTGCATGGACCACAAAGAGCTT
GTGGCTCTCTTCAGTGGATATGGGTACCAGGTTCGCTTCGTGGAGGATCTCAATAATATTGACGCGGATTTGCAC
TTCTCCATGACCTGGGCTATCGAGGAGATCCAGAGGATCCAGAAGGCTGCCCGTTCTGGGAAGCCGATCATGAAA
CCGAGGTGGCCGATGCTGATTCTGCGTACTCCCAAGGGTTGGTCGGGGCCCAAGGAGGTTCATGGCATGTTTCTC
GAGGGCTCGTTCCATTCGCACCAGGTGCCATTGCCCAAGGCAAAGACAGACAAGGAACAACTCGATCTGCTGCAG
AAGTGGCTCTCTAGTTACAAACCAGACGAGCTGTTCACTTCGACCGGTGATGTAATTGACGAGATCAAGTCTGTG
ATTCCCACAGAAGACAAAAAGAAGCTTGGTCAGCGCATTGAAGCCTACAATGGTTACAAACGACCGAATTTGCCA
GATTGGAGGCCCTTCTGCGTAGAGAAAGGCTCTGACGCAAGCGCCATGAAAGTGATTGGCAGTTTCATCAATCAG
ACATTCAAGGATAACCCGACGAACGTGCGATTGTTCTCACCGGACGAGCTGGAAAGCAACAAGCTCGATGAGGTG
TTTGAAGGCACAAACCGCAATTTCCAATGGGACCAGTTCTCCAACGCCCGCGGCGGCCGAGTAATTGAAATCCTT
AGCGAACACATGTGTCAAGGATTCCTGCAGGGTTATACCTTGACCGGTCGCATTGGTATTTTCCCGTCCTATGAA
AGCTTCCTCGGCATCATTCATACGATGATGGTGCAGTATGCAAAGTTCACTAAGATGGCGCTGGAAACAACTTGG
CACACCAGCGTCAGTAGTATAAACTACATCGAATCGAGTACTTGGACGCGCCAGGAACACAACGGCTTCTCTCAC
CAGAACCCATCTTTCATTGGCTCTGTGCTGAAACTGAAGCCCACTGCAGCTCGCGTATACTTGCCACCGGATGCG
AATACTTTCCTGACAACCGTTCACCACTGTCTAAAGTCGAGAAACTACGTCAATCTGATGGTGGGTTCGAAACAG
CCAACTCCAGTGTACCTTACCCCCAAAGAGGCCGAGAGTCACTGTCGCGCAGGAGCCTCGATCTGGAAGTTCTGT
AGCACGGACGAAGGAATTAATCCGGATGTCGTGCTGGTCGGTATTGGTGTTGAGGTGATGTTCGAAGTCATTGCA
GCGGCGGCGCTTTTGCGTAAGCTCATACCAGAGCTTCGTGTTTGTGTCATTAACGTGACGGACTTGATGATTCTT
GAGAACCAGGGTCTGCATCCACATGCCCTGTCCACTGAGGCATTCGACTCCCTCTTCACTGCTGATAAGCCTATT
CATTTCAATTACCATGGCTACCCAACTGAGCTGCAGGGCTTGCTCTTTGGACGTCCGCGTCTTGAGCGTGTCACT
GTCGCGGGCTATATTGAAGAGGGTAGCACCACCACGCCTTTCGATATGATGCTTCTCAACCGTGTCTCGCGTTAC
CATGTCGCTCAGCACGCTATTCATGGTGCTGCCAAGGGAAATGAGAAGATCCGGGTGTATCAGCAGGAGCTGAAT
GCTCAGCTGGAGGGGAGTATCGTCAACACGAGGAGGTATATTGTGGCAAACCGCGACGATCCTCCGGGTATCTAT
GACACGCCACAATTCCACAACTTCCACAAACCGGCTGAGCCATTCTGGGATCTTGAGTAG
Transcript >Pro_DTO377G3_2|g2717.t1
ATGCCTGCAGAAATTATAGACCAACCAAATCCAGCTGCGCTGCCGTCGTATCTACCAGATTATCTTGAGAAACTG
AGCGTCAAGTTGGATCATGAGAAACTAGATGAAAAAGCTTGTGATGCCTTGCTCAAGTTTCGCCGAGCGGCTTGT
TACATTGCGGCAGCTATGATATTTTTGCAAGAAAATACTCTTTTAAAGTCGGAACTCACACCTCACGACATCAAA
CCTCGACTACTCGGTCATTGGGGAACATGTCCGGGCCTAATTTTGGTCTACTCTCATCTGAACTACCTGATCCGG
ACAAGGAACCTGGACATGCTGTACGTTGTCGGCCCAGGACATGGTGCACCAGCAATCCTAGCCGCACTATGGCTA
GAGGGCTCGCTGGAGAGATTTTATCCCGAATATTCGCGAGACAGCAAAGGCCTGCACAAACTGATCTCGAGCTTT
AGCACAACAGCTGGCTTTCCTAGCCACATCAATGCTGAAACCCCTGGTGCTATCCATGAAGGTGGAGAACTGGGA
TACGCTCTAGCAGTGTCCTTTGGCGCTGTCATGGACAACCCCGATCTGATAGTGCCTTGTATCGTGGGTGACGGA
GAGGCTGAAACCGGTGCCACCGCCACGTCCTGGCATGCAATCAAGTACATTGATCCCAAGGAATCTGGTGCAGTT
TTGCCAATTCTGCATCTGAATGGTTTCAAAATCAGCGAGCGCACAATATTTGGGTGCATGGACCACAAAGAGCTT
GTGGCTCTCTTCAGTGGATATGGGTACCAGGTTCGCTTCGTGGAGGATCTCAATAATATTGACGCGGATTTGCAC
TTCTCCATGACCTGGGCTATCGAGGAGATCCAGAGGATCCAGAAGGCTGCCCGTTCTGGGAAGCCGATCATGAAA
CCGAGGTGGCCGATGCTGATTCTGCGTACTCCCAAGGGTTGGTCGGGGCCCAAGGAGGTTCATGGCATGTTTCTC
GAGGGCTCGTTCCATTCGCACCAGGTGCCATTGCCCAAGGCAAAGACAGACAAGGAACAACTCGATCTGCTGCAG
AAGTGGCTCTCTAGTTACAAACCAGACGAGCTGTTCACTTCGACCGGTGATGTAATTGACGAGATCAAGTCTGTG
ATTCCCACAGAAGACAAAAAGAAGCTTGGTCAGCGCATTGAAGCCTACAATGGTTACAAACGACCGAATTTGCCA
GATTGGAGGCCCTTCTGCGTAGAGAAAGGCTCTGACGCAAGCGCCATGAAAGTGATTGGCAGTTTCATCAATCAG
ACATTCAAGGATAACCCGACGAACGTGCGATTGTTCTCACCGGACGAGCTGGAAAGCAACAAGCTCGATGAGGTG
TTTGAAGGCACAAACCGCAATTTCCAATGGGACCAGTTCTCCAACGCCCGCGGCGGCCGAGTAATTGAAATCCTT
AGCGAACACATGTGTCAAGGATTCCTGCAGGGTTATACCTTGACCGGTCGCATTGGTATTTTCCCGTCCTATGAA
AGCTTCCTCGGCATCATTCATACGATGATGGTGCAGTATGCAAAGTTCACTAAGATGGCGCTGGAAACAACTTGG
CACACCAGCGTCAGTAGTATAAACTACATCGAATCGAGTACTTGGACGCGCCAGGAACACAACGGCTTCTCTCAC
CAGAACCCATCTTTCATTGGCTCTGTGCTGAAACTGAAGCCCACTGCAGCTCGCGTATACTTGCCACCGGATGCG
AATACTTTCCTGACAACCGTTCACCACTGTCTAAAGTCGAGAAACTACGTCAATCTGATGGTGGGTTCGAAACAG
CCAACTCCAGTGTACCTTACCCCCAAAGAGGCCGAGAGTCACTGTCGCGCAGGAGCCTCGATCTGGAAGTTCTGT
AGCACGGACGAAGGAATTAATCCGGATGTCGTGCTGGTCGGTATTGGTGTTGAGGTGATGTTCGAAGTCATTGCA
GCGGCGGCGCTTTTGCGTAAGCTCATACCAGAGCTTCGTGTTTGTGTCATTAACGTGACGGACTTGATGATTCTT
GAGAACCAGGGTCTGCATCCACATGCCCTGTCCACTGAGGCATTCGACTCCCTCTTCACTGCTGATAAGCCTATT
CATTTCAATTACCATGGCTACCCAACTGAGCTGCAGGGCTTGCTCTTTGGACGTCCGCGTCTTGAGCGTGTCACT
GTCGCGGGCTATATTGAAGAGGGTAGCACCACCACGCCTTTCGATATGATGCTTCTCAACCGTGTCTCGCGTTAC
CATGTCGCTCAGCACGCTATTCATGGTGCTGCCAAGGGAAATGAGAAGATCCGGGTGTATCAGCAGGAGCTGAAT
GCTCAGCTGGAGGGGAGTATCGTCAACACGAGGAGGTATATTGTGGCAAACCGCGACGATCCTCCGGGTATCTAT
GACACGCCACAATTCCACAACTTCCACAAACCGGCTGAGCCATTCTGGGATCTTGAGTAG
Gene >Pro_DTO377G3_2|g2717.t1
ATGCCTGCAGAAATTATAGACCAACCAAATCCAGCTGCGCTGCCGTCGTATCTACCAGATTATCTTGAGAAACTG
AGCGTCAAGTTGGATCATGAGAAACTAGATGAAAAAGCTTGTGATGCCTTGCTCAAGTTTCGCCGAGCGGCTTGT
TACATTGCGGCAGGTAATTGTGGTTATGTGCTATATATATTGCAACGGCGCGACTGACTTATTGCTAGCTATGAT
ATTTTTGCAAGAAAATACTCTTTTAAAGTCGGAACTCACACCTCACGACATCAAACCTCGACTACTCGGTGAGTA
GCATCCCCGAATTATTCAATTCGGCCATCGTGACTGATGTCATACCCCCAGGTCATTGGGGAACATGTCCGGGCC
TAATTTTGGTCTACTCTCATCTGAACTACCTGATCCGGACAAGGAACCTGGACATGCTGTACGTTGTCGGCCCAG
GACATGGTGCACCAGCAATCCTAGCCGCACTATGGCTAGAGGGCTCGCTGGAGAGATTTTATCCCGAATATTCGC
GAGACAGCAAAGGCCTGCACAAACTGATCTCGAGCTTTAGCACAACAGCTGGCTTTCCTAGGTTGGTGCCTTGCC
TTGCCATGCTATTTAGATCTTCGGCTAACAGTTATGCGCAGCCACATCAATGCTGAAACCCCTGGTGCTATCCAT
GAAGGTGGAGAACTGGGATACGCTCTAGCAGTGTCCTTTGGCGCTGTCATGGACAACCCCGATCTGATAGTGCCT
TGTATCGTGGGTGACGGAGAGGCTGAAACCGGTGCCACCGCCACGTTCGTCGATTATTTTCCCCTTTGCACTGTA
CAACGCTGATAGCGGACAGGTCCTGGCATGCAATCAAGTACATTGATCCCAAGGAATCTGGTGCAGTTTTGCCAA
TTCTGCATCTGAATGGTTTCAAAATCAGCGAGCGCACAATATTTGGGTGCATGGACCACAAAGAGCTTGTGGCTC
TCTTCAGTGGATATGGGTACCAGGTTCGCTTCGTGGAGGATCTCAATAATATTGACGCGGATTTGCACTTCTCCA
TGACCTGGGCTATCGAGGAGATCCAGAGGATCCAGAAGGCTGCCCGTTCTGGGAAGCCGATCATGAAACCGAGGT
GGCCGATGCTGATTCTGCGTACTCCCAAGGGTTGGTCGGGGCCCAAGGAGGTTCATGGCATGTTTCTCGAGGGCT
CGTTCCATTCGCACCAGGTGCCATTGCCCAAGGCAAAGACAGACAAGGAACAACTCGATCTGCTGCAGAAGTGGC
TCTCTAGTTACAAACCAGACGAGCTGTTCACTTCGACCGGTGATGTAATTGACGAGATCAAGTCTGTGATTCCCA
CAGAAGACAAAAAGAAGCTTGGTCAGCGCATTGAAGCCTACAATGGTTACAAACGACCGAATTTGCCAGATTGGA
GGCCCTTCTGCGTAGAGAAAGGCTCTGACGCAAGCGCCATGAAAGTGATTGGCAGTTTCATCAATCAGACATTCA
AGGATAACCCGACGAACGTGCGATTGTTCTCACCGGACGAGCTGGAAAGCAACAAGCTCGATGAGGTGTTTGAAG
GCACAAACCGCAATTTCCAATGGGACCAGTTCTCCAACGCCCGCGGCGGCCGAGTAATTGAAATCCTTAGCGAAC
ACATGTGTCAAGGATTCCTGCAGGGTTATACCTTGACCGGTCGCATTGGTATTTTCCCGTCCTATGAAAGCTTCC
TCGGCATCATTCATACGATGATGGTGCAGTATGCAAAGTTCACTAAGATGGTCAGCTTCCCTTTTCCCTTGCTAA
TGTCAATTCTATGCTCACCAAATATTTAGGCGCTGGAAACAACTTGGCACACCAGCGTCAGTAGTATAAACTACA
TCGAATCGAGTACTTGGACGCGCCAGGAACACAACGGCTTCTCTCACCAGAACCCATCTTTCATTGGCTCTGTGC
TGAAACTGAAGCCCACTGCAGCTCGCGTATACTTGCCACCGGATGCGAATACTTTCCTGACAACCGTTCACCACT
GTCTAAAGTCGAGAAACTACGTCAATCTGATGGTGGGTTCGAAACAGCCAACTCCAGTGTACCTTACCCCCAAAG
AGGCCGAGAGTCACTGTCGCGCAGGAGCCTCGATCTGGAAGTTCTGTAGCACGGACGAAGGAATTAATCCGGATG
TCGTGCTGGTCGGTATTGGTGTTGAGGTGATGTTCGAAGTCATTGCAGCGGCGGCGCTTTTGCGTAAGCTCATAC
CAGAGCTTCGTGTTTGTGTCATTAACGTGACGGACTTGATGATTCTTGAGAACCAGGGTCTGCATCCACATGCCC
TGTCCACTGAGGCATTCGACTCCCTCTTCACTGCTGATAAGCCTATTCATTTCAATTACCATGGCTACCCAACTG
AGCTGCAGGGCTTGCTCTTTGGACGTCCGCGTCTTGAGCGTGTCACTGTCGCGGGCTATATTGAAGAGGGTAGCA
CCACCACGCCTTTCGATATGATGCTTCTCAACCGTGTCTCGCGTTACCATGTCGCTCAGCACGCTATTCATGGTG
CTGCCAAGGGAAATGAGAAGATCCGGGTGTATCAGCAGGAGCTGAATGCTCAGCTGGAGGGGAGTATCGTCAACA
CGAGGAGGTATATTGTGGCAAACCGCGACGGTGAGTACTCTATCCTCTTTGCAATTTTCCATGCAATACTGACTT
TCACTCATAGATCCTCCGGGTATCTATGACACGCCACAATTCCACAACTTCCACAAACCGGCTGAGCCATTCTGG
GATCTTGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail