Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2716.t1
Gene name
Locationscaffold_03:762630..764307
Strand-
Gene length (bp)1677
Transcript length (bp)1245
Coding sequence length (bp)1245
Protein length (aa) 415

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00871 Acetate_kinase Acetokinase family 1.6E-93 5 405

GO

GO Term Description Terminal node
GO:0016774 phosphotransferase activity, carboxyl group as acceptor Yes
GO:0016310 phosphorylation Yes
GO:0005622 intracellular Yes
GO:0016301 kinase activity Yes
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0008152 metabolic process No
GO:0005575 cellular_component No
GO:0003824 catalytic activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044464 cell part No
GO:0003674 molecular_function No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2716.t1
MTKSILAVNAGSSSVKINFYTLENPPRLIADASISGITAPPPTFKYHKGDKKHKQDVKQILSTPQDAFKYLLQRC
FSDPELSEVASIDDLEYICHRVVHGGDYLDAVLINDETLDRLKKLEDLAPLHNFSALEIVRLCKAEFPKVPSITF
FDSCFHQTIPEAVRTYPINQEIAKANGLRKYGFHGISYSFILRTVAQFLNKPKEKTNLIVMHIGSGASICAIKNG
ESVDTSMGLTPLAGLPGATRSGSIDPSLVFHYTNEAGHLNPGSTTSMHISTAENILNKQSGWEALTGTTDFSKIA
VANPPTKAHKLAFDIVVDRISGYIGSYYVKLNGELDGVVFAGGIGEKSALLRKALVDKCQCLGLAIDDAANDKGP
GDDETVKDISKDSGKGPRVLICQTNEQFEMAYHCAASRS*
Coding >Pro_DTO377G3_2|g2716.t1
ATGACTAAATCTATCCTAGCTGTTAACGCGGGTTCATCTTCCGTCAAAATCAACTTCTATACCCTCGAGAACCCA
CCGAGACTGATCGCAGATGCGTCGATCTCCGGAATTACTGCACCCCCACCTACATTCAAGTACCACAAGGGAGAC
AAGAAACACAAACAGGATGTCAAACAAATACTCAGCACCCCCCAAGATGCATTCAAGTATCTCCTGCAGCGCTGT
TTTAGCGACCCTGAGCTTTCAGAAGTCGCTAGCATCGACGATTTGGAGTACATCTGCCACCGAGTCGTCCACGGA
GGAGACTACCTCGACGCAGTCCTCATCAACGATGAGACACTTGATCGCTTGAAGAAATTGGAAGACCTCGCACCT
CTTCACAATTTCTCCGCGCTGGAGATAGTCCGCCTGTGCAAAGCAGAGTTCCCCAAAGTTCCAAGCATCACCTTC
TTCGACTCTTGTTTCCACCAGACAATCCCCGAAGCTGTCCGCACGTACCCAATCAACCAGGAAATTGCCAAGGCC
AATGGTCTGCGCAAGTATGGCTTCCACGGCATCAGCTACTCGTTCATCCTGCGGACTGTAGCACAATTTTTGAAC
AAACCGAAGGAGAAGACGAATCTTATCGTTATGCATATCGGGAGCGGGGCGTCGATCTGTGCGATCAAGAACGGA
GAGTCGGTGGATACATCAATGGGCCTCACTCCTTTGGCAGGATTACCCGGTGCAACGCGTAGTGGAAGTATTGAT
CCATCATTGGTCTTCCACTATACCAACGAAGCAGGCCATCTAAACCCAGGCAGCACGACAAGTATGCATATTAGC
ACGGCTGAGAACATCCTCAATAAACAATCAGGTTGGGAAGCCCTCACAGGAACAACCGACTTCTCCAAGATCGCA
GTGGCGAATCCACCAACCAAAGCACATAAACTTGCTTTCGATATCGTCGTCGACCGCATCTCGGGCTACATCGGC
AGCTACTACGTTAAACTAAACGGTGAATTAGACGGTGTAGTCTTCGCCGGTGGGATCGGTGAGAAGAGTGCCTTG
CTGAGAAAAGCACTTGTCGATAAATGCCAGTGTCTAGGCTTGGCAATCGACGATGCGGCTAATGACAAGGGGCCT
GGAGATGATGAGACGGTCAAGGATATCTCCAAGGATTCCGGCAAGGGGCCCCGGGTTTTGATTTGCCAGACCAAT
GAACAGTTTGAAATGGCATACCACTGTGCAGCTTCGAGGAGCTGA
Transcript >Pro_DTO377G3_2|g2716.t1
ATGACTAAATCTATCCTAGCTGTTAACGCGGGTTCATCTTCCGTCAAAATCAACTTCTATACCCTCGAGAACCCA
CCGAGACTGATCGCAGATGCGTCGATCTCCGGAATTACTGCACCCCCACCTACATTCAAGTACCACAAGGGAGAC
AAGAAACACAAACAGGATGTCAAACAAATACTCAGCACCCCCCAAGATGCATTCAAGTATCTCCTGCAGCGCTGT
TTTAGCGACCCTGAGCTTTCAGAAGTCGCTAGCATCGACGATTTGGAGTACATCTGCCACCGAGTCGTCCACGGA
GGAGACTACCTCGACGCAGTCCTCATCAACGATGAGACACTTGATCGCTTGAAGAAATTGGAAGACCTCGCACCT
CTTCACAATTTCTCCGCGCTGGAGATAGTCCGCCTGTGCAAAGCAGAGTTCCCCAAAGTTCCAAGCATCACCTTC
TTCGACTCTTGTTTCCACCAGACAATCCCCGAAGCTGTCCGCACGTACCCAATCAACCAGGAAATTGCCAAGGCC
AATGGTCTGCGCAAGTATGGCTTCCACGGCATCAGCTACTCGTTCATCCTGCGGACTGTAGCACAATTTTTGAAC
AAACCGAAGGAGAAGACGAATCTTATCGTTATGCATATCGGGAGCGGGGCGTCGATCTGTGCGATCAAGAACGGA
GAGTCGGTGGATACATCAATGGGCCTCACTCCTTTGGCAGGATTACCCGGTGCAACGCGTAGTGGAAGTATTGAT
CCATCATTGGTCTTCCACTATACCAACGAAGCAGGCCATCTAAACCCAGGCAGCACGACAAGTATGCATATTAGC
ACGGCTGAGAACATCCTCAATAAACAATCAGGTTGGGAAGCCCTCACAGGAACAACCGACTTCTCCAAGATCGCA
GTGGCGAATCCACCAACCAAAGCACATAAACTTGCTTTCGATATCGTCGTCGACCGCATCTCGGGCTACATCGGC
AGCTACTACGTTAAACTAAACGGTGAATTAGACGGTGTAGTCTTCGCCGGTGGGATCGGTGAGAAGAGTGCCTTG
CTGAGAAAAGCACTTGTCGATAAATGCCAGTGTCTAGGCTTGGCAATCGACGATGCGGCTAATGACAAGGGGCCT
GGAGATGATGAGACGGTCAAGGATATCTCCAAGGATTCCGGCAAGGGGCCCCGGGTTTTGATTTGCCAGACCAAT
GAACAGTTTGAAATGGCATACCACTGTGCAGCTTCGAGGAGCTGA
Gene >Pro_DTO377G3_2|g2716.t1
ATGACTAAATCTATCCTAGCTGTTAACGCGGGTTCATCTTCCGTCAAAATCAACTTCTATACCCTCGAGAACCCA
CCGAGACTGATCGCAGATGCGTCGATCTCCGGAATTACTGCACCCCCACCTACATTCAAGTACCACAAGGGAGAC
AAGAAACACAAACAGGATGTCAAACAAATACTCAGCACCCCCCAAGATGCATTCAAGTATCTCCTGCAGCGCTGT
TTTAGCGACCCTGAGCTTTCAGAAGTCGCTAGCATCGACGATTTGGAGTACATCTGCCACCGAGTCGTCCACGGA
GGAGACTACCTCGACGCAGTCCTCATCAACGATGAGACACTTGATCGCTTGAAGAAATTGGAAGACCTCGCACCT
CTGTAAGCTCATATATCTCGAGTCTTCATATTTCCGGGATTTTATACCTGGAATCGACTATATACCTGCCTTGGT
CAATACCCCGCTAACCCCGCCCGACCAAAAGTCACAATTTCTCCGCGCTGGAGATAGTCCGCCTGTGCAAAGCAG
AGTTCCCCAAAGTTCCAAGCATCACCTTCTTCGACTCTTGTTTCCACCAGACAATCCCCGAAGCTGTCCGCACGT
ACCCAATCAACCAGGAAATTGCCAAGGCCAATGGTCTGCGCAAGTATGGCTTCCACGGCATCAGCTACTCGTTCA
TCCTGCGGACTGTAGCACAATTTTTGAACAAACCGAAGGAGAAGACGAATCTTATCGTTATGCATATCGGGAGCG
GGGCGTCGATCTGTGCGATCAAGAACGGAGAGTCGGTGGATACATCGTGAGTCCCGCAAAGTTTATATTGCATCT
CAATCTATCTCGAGTTGAGAGTCGTGCTAACACGGTGACTAGAATGGGCCTCACTCCTTTGGCAGGATTACCCGG
TGCAACGCGTAGTGGAAGTATTGATCCATCGTGAGTTACATCCAATGGGCTTTCTTGGCAATGAAACTATGGCCA
ACTAATACTTGGTGATCTAGATTGGTCTTCCACTATACCAACGAAGCAGGCCATCTAAACCCAGGCAGCACGACA
AGTATGCATATTAGCACGGTATGAATACCCAAGAACCAGTGCCAAAAAGGAGAGCAAGGAAAATACTAACCCAAT
CCAACACCTTCAGGCTGAGAACATCCTCAATAAACAATCAGGTTGGGAAGCCCTCACAGGAACAACCGACTTCTC
CAAGATCGCAGTGGCGAATCCACCAACCAAAGCACATAAACTTGCTTTCGATATCGTCGTCGACCGCATCTCGGG
CTACATCGGCAGCTACTACGTTAAACTAAACGGTGAATTAGACGGTGTAGTCTTCGCCGGTGGGATCGGTGAGAA
GAGTGCCTTGCTGAGAAAAGCACTTGTCGATAAATGCCAGTGTCTAGGCTTGGCAATCGACGATGCGGCTAATGA
CAAGGGGCCTGGAGATGATGAGACGGTCAAGGATATCTCCAAGGATTCCGGCAAGGGGCCCCGGGTTTTGATTTG
CCAGACCAATGAACAGGTATGTGGTCTCAAATATTGAGGATTATTGACCGTGACCGTAACCTTGACCTCTCTTGG
AGGTGAAGGTTTAGGTTATAGGTTGTTTTGCTTTGATTTACTGACTTGGGATTTCACTTACAGTTTGAAATGGCA
TACCACTGTGCAGCTTCGAGGAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail