Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2714.t1
Gene name
Locationscaffold_03:754297..755338
Strand-
Gene length (bp)1041
Transcript length (bp)786
Coding sequence length (bp)786
Protein length (aa) 262

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00071 Ras Ras family 1.3E-56 17 215
PF08477 Roc Ras of Complex, Roc, domain of DAPkinase 3.7E-34 17 131
PF00025 Arf ADP-ribosylation factor family 5.4E-14 12 135
PF01926 MMR_HSR1 50S ribosome-binding GTPase 1.2E-04 18 116

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0016462 pyrophosphatase activity No
GO:0000166 nucleotide binding No
GO:0005488 binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0003674 molecular_function No
GO:0032561 guanyl ribonucleotide binding No
GO:0019001 guanyl nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0016787 hydrolase activity No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 282.65 172.62 392.69
5d_25C Five days - 25 degrees Celsius 355.62 214.94 496.31
7d_25C Seven days - 25 degrees Celsius 406.02 241.53 570.52
10d_25C Ten days - 25 degrees Celsius 580.54 341.62 819.46
7d_15C Seven days - 15 degrees Celsius 362.89 217.58 508.20
7d_30C Seven days - 30 degrees Celsius 365.18 215.70 514.66

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.342120 no
3d_25C 7d_25C 0.099736 no
3d_25C 7d_15C 0.289356 no
3d_25C 7d_30C 0.278124 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.637510 no
5d_25C 7d_15C 0.953512 no
5d_25C 7d_30C 0.939393 no
5d_25C 10d_25C 0.020660 yes
7d_25C 7d_15C 0.696129 no
7d_25C 7d_30C 0.720275 no
7d_25C 10d_25C 0.116817 no
7d_15C 7d_30C 0.986167 no
7d_15C 10d_25C 0.026584 yes
7d_30C 10d_25C 0.030434 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2714.t1
MSESANANAPKPSSSVKLVLLGEAAVGKSSLVLRFVNNDFQENKEPTIGAAFLTQKCSLPTRTIKFEIWDTAGQE
RFASLAPMYYRNAQAALVVYDVTKPSSLTKAKHWVAELQRQASPGIVIALVGNKLDLTNDGGDVSEAVGATQSEP
ESAQGGDEGAGEEDEGQDVVSGDARKVSTRDATAYAEDEGLLFFETSAKTGTNVVEVFTAIANAIPESSLKTGRG
TGAGTGQTSLGNRSAEDSRVNLGDRNAATAKEGCAC*
Coding >Pro_DTO377G3_2|g2714.t1
ATGTCCGAATCAGCGAACGCAAATGCCCCGAAGCCGAGCAGCAGCGTCAAGCTTGTGCTGCTCGGAGAGGCCGCA
GTGGGCAAGTCATCGCTTGTCCTCCGCTTTGTCAACAATGATTTCCAGGAGAATAAGGAACCAACTATTGGCGCT
GCTTTTTTGACGCAAAAATGCTCCCTTCCTACGCGCACGATCAAGTTCGAGATCTGGGACACCGCCGGCCAAGAG
CGATTCGCTTCGCTCGCCCCGATGTACTACCGCAACGCACAGGCGGCGCTTGTTGTCTACGACGTCACGAAACCC
TCTTCGCTGACAAAAGCCAAGCACTGGGTCGCCGAGCTGCAGCGCCAAGCGAGCCCTGGAATCGTCATTGCCCTC
GTCGGTAACAAGCTGGACTTGACCAATGACGGCGGAGATGTTTCCGAGGCCGTTGGCGCTACACAGAGCGAGCCT
GAGTCGGCCCAAGGTGGAGATGAAGGTGCCGGTGAGGAAGACGAGGGGCAGGATGTCGTGTCCGGCGATGCTCGC
AAGGTATCGACACGAGACGCTACCGCCTATGCGGAGGATGAGGGTCTTCTGTTCTTCGAGACTAGCGCCAAGACC
GGAACCAATGTTGTGGAAGTCTTCACGGCAATTGCAAATGCCATCCCCGAGAGCAGTCTGAAGACTGGTCGCGGT
ACCGGTGCCGGAACTGGTCAGACTTCGTTGGGTAATCGGTCAGCAGAAGACTCACGGGTCAACCTGGGTGATCGA
AATGCTGCTACGGCTAAGGAAGGCTGCGCTTGCTGA
Transcript >Pro_DTO377G3_2|g2714.t1
ATGTCCGAATCAGCGAACGCAAATGCCCCGAAGCCGAGCAGCAGCGTCAAGCTTGTGCTGCTCGGAGAGGCCGCA
GTGGGCAAGTCATCGCTTGTCCTCCGCTTTGTCAACAATGATTTCCAGGAGAATAAGGAACCAACTATTGGCGCT
GCTTTTTTGACGCAAAAATGCTCCCTTCCTACGCGCACGATCAAGTTCGAGATCTGGGACACCGCCGGCCAAGAG
CGATTCGCTTCGCTCGCCCCGATGTACTACCGCAACGCACAGGCGGCGCTTGTTGTCTACGACGTCACGAAACCC
TCTTCGCTGACAAAAGCCAAGCACTGGGTCGCCGAGCTGCAGCGCCAAGCGAGCCCTGGAATCGTCATTGCCCTC
GTCGGTAACAAGCTGGACTTGACCAATGACGGCGGAGATGTTTCCGAGGCCGTTGGCGCTACACAGAGCGAGCCT
GAGTCGGCCCAAGGTGGAGATGAAGGTGCCGGTGAGGAAGACGAGGGGCAGGATGTCGTGTCCGGCGATGCTCGC
AAGGTATCGACACGAGACGCTACCGCCTATGCGGAGGATGAGGGTCTTCTGTTCTTCGAGACTAGCGCCAAGACC
GGAACCAATGTTGTGGAAGTCTTCACGGCAATTGCAAATGCCATCCCCGAGAGCAGTCTGAAGACTGGTCGCGGT
ACCGGTGCCGGAACTGGTCAGACTTCGTTGGGTAATCGGTCAGCAGAAGACTCACGGGTCAACCTGGGTGATCGA
AATGCTGCTACGGCTAAGGAAGGCTGCGCTTGCTGA
Gene >Pro_DTO377G3_2|g2714.t1
ATGTCCGAATCAGCGAACGCAAATGCCCCGAAGCCGAGCAGCAGCGTCAAGCTTGTGCTGCTCGGAGAGGCCGCA
GTGGGCAAGGTACTGCTCTATTCGTCATGTTACATGATTTTGACAGCTAACCGTCTCTTGTTATTCGCCCATAGT
CATCGCTTGTCCTCCGCTTTGTCAACAATGATTTCCAGGAGAATAAGGAACCAACTATTGGCGGTAAGATTTCCC
CATGGACTTAGCCCCCCCCCACAGGATACAAGGTACTGTTCCTGGCAGATCATAAACTTTTTGGAGAATCCAGGG
ACGGTGTGTTGTATCCAAAATTGAGTTGTTCCCCGCAAACGGGGCAACCCGGCCCCTTAATAATACTTTGCACTA
GAATAACCATCTAACGTCGTCTTTCCAGCTGCTTTTTTGACGCAAAAATGCTCCCTTCCTACGCGCACGATCAAG
TTCGAGATCTGGGACACCGCCGGCCAAGAGCGATTCGCTTCGCTCGCCCCGATGTACTACCGCAACGCACAGGCG
GCGCTTGTTGTCTACGACGTCACGAAACCCTCTTCGCTGACAAAAGCCAAGCACTGGGTCGCCGAGCTGCAGCGC
CAAGCGAGCCCTGGAATCGTCATTGCCCTCGTCGGTAACAAGCTGGACTTGACCAATGACGGCGGAGATGTTTCC
GAGGCCGTTGGCGCTACACAGAGCGAGCCTGAGTCGGCCCAAGGTGGAGATGAAGGTGCCGGTGAGGAAGACGAG
GGGCAGGATGTCGTGTCCGGCGATGCTCGCAAGGTATCGACACGAGACGCTACCGCCTATGCGGAGGATGAGGGT
CTTCTGTTCTTCGAGACTAGCGCCAAGACCGGAACCAATGTTGTGGAAGTCTTCACGGCAATTGCAAATGCCATC
CCCGAGAGCAGTCTGAAGACTGGTCGCGGTACCGGTGCCGGAACTGGTCAGACTTCGTTGGGTAATCGGTCAGCA
GAAGACTCACGGGTCAACCTGGGTGATCGAAATGCTGCTACGGCTAAGGAAGGCTGCGCTTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail