Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2709.t1
Gene name
Locationscaffold_03:742564..746629
Strand+
Gene length (bp)4065
Transcript length (bp)3756
Coding sequence length (bp)3756
Protein length (aa) 1252

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00689 Cation_ATPase_C Cation transporting ATPase, C-terminus 1.9E-47 969 1148
PF00122 E1-E2_ATPase E1-E2 ATPase 1.8E-37 327 536
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 7.4E-19 555 896
PF13246 Cation_ATPase Cation transport ATPase (P-type) 7.1E-19 616 703
PF00690 Cation_ATPase_N Cation transporter/ATPase, N-terminus 1.6E-07 230 273

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 262 283 21
2 288 310 22
3 461 483 22
4 503 525 22
5 942 964 22
6 1020 1039 19
7 1093 1115 22
8 1125 1144 19
9 1151 1168 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2709.t1
MSSSNNDPSYQGSLLSPVIVTDFSGRERSMSTASSAWSGPTDLNHSPTSPVSPDMAWNPPDPARLMVQNASHRLS
QSIDGDTLRPRADSFASSADTVVRSRANSEVDPTHTSKDVYDDVSLSDALKPDPRNEADFQVEDNRFAFSPGQLN
KMQNPKSLAAFHALGGLQGLERGLRTDLKAGLSIDEGCLEGNVEFQDVAPSAQHTATEKSPSKPVTSAPAPVSSG
HGSPFEDRIRVFSQNKLPARKSTGFLKLFWAAYNDKIIILLTIAAVVSLSLGIYETVSEGTGVQWVEGVAICVAI
LIVTIVTAANDWQKERQFAKLNKRNDDRQVQVTRSGKPDMVSIYDIMVGDILHLEAGDSIPADGILVSGYGVKCD
ESSATGESDQMKKTPGHEVWQQIVDGKATKKLDPFLISGSKVLEGLGTYVVTSVGPYSTYGRILLSLQTPNDPTP
LQVKLGKLADWIGYLGTAAAGILFFVLLFRFVADLPNHPERNGAVKGKEFVDILIVAVTVIVVAIPEGLPLAVTL
ALAFATTRMVKENNLVRVLRACETMGNATVICSDKTGTLTQNKMTVVAGTWGSNQNFSQRTEDEDVEGSMTTSAI
SQKLSAPIKDLIIKSIALNSTAFEREKDGSIDFVGSKTEVAMLQLARDYMGMDLVSERGSAEITQLIPFDSDRKC
MGVVYRVPGAGYRLLVKGASELMVGVCTAEIVNIDISKERPDVEQLSDEQKKNLLEIIDNYAHKSLRTIGIVYKD
FASWPPIEAKHSEDPSANFEDFFHDMTWVGVVGIQDPLRPEVPSAIRKCHSAGVQVKMVTGDNVATATAIATSCG
IKTEDGLVMEGPKFRQLTNEEMDEVVPRLQVLARSSPEDKRILVERLKALGETVAVTGDGTNDGPALRTADVGFS
MGIAGTEVAKEASSIILLDDNFKSIITAIAWGRAVNDAVAKFLQFQVTVNITAVILTFVSSVYSSENTSVLTAVQ
LLWVNLIMDTFAALALATDAPTEKILDRKPVSKHASLFTMTMWKMILGQAVYQLAITFMLYFAGEKLLNAHLSSE
PEMRAKQLSTVVFNTFVWMQIFNEFNNRRLDNKFNIFEGMFRNYWFLGINAIMIGGQVMIVFVGGQAFNVTRLNG
TLWGVCLICSIACLPWAIVLRLIPDYYFGLVFNAVVGGMAVVLRPLSKGCKVIGRGIRSFFRPVKRFTRRIFNKR
KSEDELELKPKSTDPEEAPERLQLNTQKPSPERLATPTPVVIPPITITTSP*
Coding >Pro_DTO377G3_2|g2709.t1
ATGTCTTCTTCAAACAATGACCCCTCCTATCAGGGCTCGCTATTGAGTCCTGTTATAGTGACGGACTTTTCAGGC
AGAGAGCGATCTATGTCTACAGCCTCTTCTGCATGGTCGGGTCCTACAGATCTAAATCACAGCCCGACTTCTCCT
GTCTCACCAGATATGGCGTGGAACCCACCAGACCCAGCTCGGCTGATGGTTCAAAATGCCTCGCATCGACTGTCA
CAGTCGATCGATGGCGATACATTGCGTCCGCGGGCGGATTCATTCGCTTCTTCAGCAGATACCGTAGTTCGTTCG
CGGGCGAACTCCGAGGTAGACCCGACCCATACTTCCAAAGATGTCTACGACGATGTCTCGCTGTCGGATGCTTTG
AAACCGGACCCGAGGAATGAAGCCGATTTCCAGGTGGAGGATAATCGGTTTGCGTTCTCCCCGGGTCAACTGAAC
AAAATGCAGAACCCAAAGTCCTTGGCTGCATTCCATGCTCTTGGTGGCTTACAAGGTCTGGAGCGGGGTCTGCGA
ACAGATCTCAAGGCCGGTTTGTCAATTGATGAAGGGTGTCTGGAGGGCAATGTCGAGTTCCAGGATGTGGCACCT
TCAGCGCAACACACAGCTACAGAAAAATCTCCATCAAAACCTGTCACCTCGGCGCCGGCGCCGGTGTCATCTGGT
CATGGTTCACCATTCGAAGACCGCATTCGTGTCTTCAGTCAGAACAAACTACCTGCTCGGAAATCGACCGGGTTC
CTGAAATTATTTTGGGCTGCATATAATGACAAAATTATTATATTATTGACCATTGCCGCCGTGGTCTCGCTATCC
CTGGGGATATACGAGACCGTGTCGGAAGGCACAGGCGTCCAGTGGGTGGAAGGAGTCGCCATCTGTGTAGCAATC
TTGATTGTTACAATCGTTACAGCTGCGAACGATTGGCAAAAAGAGAGACAATTTGCCAAGCTCAATAAACGGAAC
GATGACCGTCAAGTTCAAGTCACCCGCTCAGGCAAACCCGACATGGTTTCAATCTACGATATTATGGTCGGCGAT
ATCCTCCATCTCGAGGCAGGCGATTCCATCCCAGCAGATGGAATTCTAGTTTCAGGCTACGGGGTGAAGTGCGAT
GAGTCTTCCGCCACCGGCGAGTCGGATCAAATGAAGAAGACCCCTGGCCATGAAGTCTGGCAGCAAATTGTCGAC
GGCAAGGCAACCAAGAAACTCGACCCGTTTCTGATCTCCGGTAGCAAGGTCCTTGAAGGGTTGGGAACTTATGTT
GTCACCAGTGTTGGACCCTATTCTACCTACGGACGGATCTTGTTGTCGCTGCAGACTCCTAATGACCCAACGCCG
CTTCAAGTCAAGCTGGGTAAGTTGGCGGATTGGATTGGGTATTTGGGTACAGCAGCTGCTGGTATTCTGTTCTTT
GTTTTGCTATTCCGCTTTGTAGCCGATCTGCCCAATCACCCGGAAAGGAACGGTGCTGTGAAAGGCAAAGAGTTT
GTGGATATTCTTATTGTTGCTGTCACGGTTATTGTTGTCGCTATTCCAGAGGGTCTCCCACTAGCAGTAACGCTG
GCTTTGGCCTTCGCTACTACCCGTATGGTCAAGGAGAACAACCTAGTCCGCGTCCTTCGCGCATGCGAGACAATG
GGAAACGCCACGGTCATCTGCTCTGATAAAACAGGCACATTGACACAGAACAAAATGACCGTTGTGGCCGGAACC
TGGGGCTCGAACCAAAACTTCAGCCAGAGAACCGAAGATGAAGATGTGGAAGGTTCAATGACTACTTCGGCCATC
TCCCAGAAACTATCAGCTCCCATCAAAGATTTGATTATCAAGAGCATCGCTTTGAACTCAACTGCGTTTGAACGG
GAAAAGGACGGCTCCATCGATTTTGTCGGTAGTAAGACCGAGGTTGCGATGCTTCAGTTGGCTAGGGATTATATG
GGCATGGATCTTGTCTCGGAGCGTGGCTCCGCTGAGATCACCCAATTGATTCCTTTCGACTCCGACAGGAAGTGC
ATGGGTGTTGTTTACCGTGTTCCTGGAGCTGGCTACCGACTGCTTGTCAAGGGAGCGTCCGAGTTGATGGTCGGC
GTCTGCACCGCAGAAATTGTCAACATTGATATTTCCAAAGAGAGACCCGATGTGGAGCAGCTTTCTGACGAACAA
AAGAAAAACCTTCTGGAGATCATCGACAATTATGCCCACAAGTCTCTTCGAACGATTGGCATAGTCTACAAGGAC
TTCGCAAGCTGGCCACCGATCGAAGCCAAACATTCTGAGGATCCTTCAGCAAACTTCGAGGATTTCTTCCATGAT
ATGACTTGGGTTGGAGTTGTAGGTATCCAAGACCCTCTTCGCCCCGAAGTCCCATCGGCCATTCGCAAATGTCAC
TCGGCAGGCGTCCAGGTCAAGATGGTGACTGGTGACAACGTTGCCACTGCCACTGCTATTGCAACTTCTTGCGGA
ATCAAGACGGAAGATGGATTGGTCATGGAAGGTCCCAAGTTCCGCCAACTCACAAACGAGGAGATGGATGAAGTG
GTTCCGCGCCTGCAAGTGCTGGCACGATCATCCCCCGAAGACAAGCGAATCTTGGTCGAACGTCTCAAGGCCCTC
GGTGAAACGGTCGCCGTGACAGGTGATGGTACCAACGACGGACCGGCTTTGCGGACTGCAGATGTCGGCTTCTCC
ATGGGTATTGCTGGTACTGAGGTCGCGAAGGAGGCGAGTTCGATTATTCTCCTGGATGATAATTTCAAGTCCATC
ATCACAGCGATCGCTTGGGGACGAGCTGTTAATGACGCCGTTGCCAAGTTTTTGCAATTCCAGGTCACGGTCAAT
ATCACGGCCGTGATCCTCACTTTTGTGTCATCTGTGTACAGCAGCGAGAACACCAGTGTTTTGACAGCTGTGCAG
CTGCTCTGGGTGAACCTGATCATGGACACATTCGCCGCTCTCGCCTTAGCCACGGATGCCCCGACTGAAAAGATT
CTCGACCGCAAGCCTGTCTCCAAACACGCCTCCCTTTTCACAATGACCATGTGGAAGATGATTCTTGGCCAAGCA
GTATACCAGCTAGCCATCACATTCATGCTTTATTTCGCAGGCGAAAAGCTCCTCAACGCCCATCTCAGCTCCGAG
CCCGAGATGCGCGCGAAACAACTCTCGACCGTGGTGTTCAACACGTTCGTGTGGATGCAGATCTTCAACGAATTC
AACAATCGCCGCCTCGACAACAAGTTCAATATCTTCGAAGGCATGTTCCGCAATTACTGGTTCTTAGGAATCAAC
GCCATCATGATCGGTGGCCAGGTCATGATCGTCTTCGTGGGCGGCCAGGCATTCAACGTGACTCGCTTGAACGGC
ACCCTCTGGGGCGTGTGTTTGATCTGTTCTATTGCCTGCTTGCCCTGGGCTATCGTGCTCCGACTTATCCCAGAC
TACTATTTCGGGCTTGTTTTCAATGCCGTTGTTGGCGGTATGGCTGTTGTTTTGCGCCCGCTTTCCAAGGGGTGC
AAGGTAATCGGTCGAGGCATCAGGTCTTTCTTTAGGCCTGTGAAGCGTTTCACTCGCCGTATTTTCAACAAGCGG
AAGTCAGAAGATGAACTCGAGTTGAAACCAAAGTCTACTGATCCTGAAGAAGCTCCTGAGAGACTACAACTGAAC
ACGCAAAAGCCCTCTCCTGAGCGTCTGGCCACGCCTACTCCTGTCGTCATTCCCCCTATCACGATTACTACGTCT
CCTTAG
Transcript >Pro_DTO377G3_2|g2709.t1
ATGTCTTCTTCAAACAATGACCCCTCCTATCAGGGCTCGCTATTGAGTCCTGTTATAGTGACGGACTTTTCAGGC
AGAGAGCGATCTATGTCTACAGCCTCTTCTGCATGGTCGGGTCCTACAGATCTAAATCACAGCCCGACTTCTCCT
GTCTCACCAGATATGGCGTGGAACCCACCAGACCCAGCTCGGCTGATGGTTCAAAATGCCTCGCATCGACTGTCA
CAGTCGATCGATGGCGATACATTGCGTCCGCGGGCGGATTCATTCGCTTCTTCAGCAGATACCGTAGTTCGTTCG
CGGGCGAACTCCGAGGTAGACCCGACCCATACTTCCAAAGATGTCTACGACGATGTCTCGCTGTCGGATGCTTTG
AAACCGGACCCGAGGAATGAAGCCGATTTCCAGGTGGAGGATAATCGGTTTGCGTTCTCCCCGGGTCAACTGAAC
AAAATGCAGAACCCAAAGTCCTTGGCTGCATTCCATGCTCTTGGTGGCTTACAAGGTCTGGAGCGGGGTCTGCGA
ACAGATCTCAAGGCCGGTTTGTCAATTGATGAAGGGTGTCTGGAGGGCAATGTCGAGTTCCAGGATGTGGCACCT
TCAGCGCAACACACAGCTACAGAAAAATCTCCATCAAAACCTGTCACCTCGGCGCCGGCGCCGGTGTCATCTGGT
CATGGTTCACCATTCGAAGACCGCATTCGTGTCTTCAGTCAGAACAAACTACCTGCTCGGAAATCGACCGGGTTC
CTGAAATTATTTTGGGCTGCATATAATGACAAAATTATTATATTATTGACCATTGCCGCCGTGGTCTCGCTATCC
CTGGGGATATACGAGACCGTGTCGGAAGGCACAGGCGTCCAGTGGGTGGAAGGAGTCGCCATCTGTGTAGCAATC
TTGATTGTTACAATCGTTACAGCTGCGAACGATTGGCAAAAAGAGAGACAATTTGCCAAGCTCAATAAACGGAAC
GATGACCGTCAAGTTCAAGTCACCCGCTCAGGCAAACCCGACATGGTTTCAATCTACGATATTATGGTCGGCGAT
ATCCTCCATCTCGAGGCAGGCGATTCCATCCCAGCAGATGGAATTCTAGTTTCAGGCTACGGGGTGAAGTGCGAT
GAGTCTTCCGCCACCGGCGAGTCGGATCAAATGAAGAAGACCCCTGGCCATGAAGTCTGGCAGCAAATTGTCGAC
GGCAAGGCAACCAAGAAACTCGACCCGTTTCTGATCTCCGGTAGCAAGGTCCTTGAAGGGTTGGGAACTTATGTT
GTCACCAGTGTTGGACCCTATTCTACCTACGGACGGATCTTGTTGTCGCTGCAGACTCCTAATGACCCAACGCCG
CTTCAAGTCAAGCTGGGTAAGTTGGCGGATTGGATTGGGTATTTGGGTACAGCAGCTGCTGGTATTCTGTTCTTT
GTTTTGCTATTCCGCTTTGTAGCCGATCTGCCCAATCACCCGGAAAGGAACGGTGCTGTGAAAGGCAAAGAGTTT
GTGGATATTCTTATTGTTGCTGTCACGGTTATTGTTGTCGCTATTCCAGAGGGTCTCCCACTAGCAGTAACGCTG
GCTTTGGCCTTCGCTACTACCCGTATGGTCAAGGAGAACAACCTAGTCCGCGTCCTTCGCGCATGCGAGACAATG
GGAAACGCCACGGTCATCTGCTCTGATAAAACAGGCACATTGACACAGAACAAAATGACCGTTGTGGCCGGAACC
TGGGGCTCGAACCAAAACTTCAGCCAGAGAACCGAAGATGAAGATGTGGAAGGTTCAATGACTACTTCGGCCATC
TCCCAGAAACTATCAGCTCCCATCAAAGATTTGATTATCAAGAGCATCGCTTTGAACTCAACTGCGTTTGAACGG
GAAAAGGACGGCTCCATCGATTTTGTCGGTAGTAAGACCGAGGTTGCGATGCTTCAGTTGGCTAGGGATTATATG
GGCATGGATCTTGTCTCGGAGCGTGGCTCCGCTGAGATCACCCAATTGATTCCTTTCGACTCCGACAGGAAGTGC
ATGGGTGTTGTTTACCGTGTTCCTGGAGCTGGCTACCGACTGCTTGTCAAGGGAGCGTCCGAGTTGATGGTCGGC
GTCTGCACCGCAGAAATTGTCAACATTGATATTTCCAAAGAGAGACCCGATGTGGAGCAGCTTTCTGACGAACAA
AAGAAAAACCTTCTGGAGATCATCGACAATTATGCCCACAAGTCTCTTCGAACGATTGGCATAGTCTACAAGGAC
TTCGCAAGCTGGCCACCGATCGAAGCCAAACATTCTGAGGATCCTTCAGCAAACTTCGAGGATTTCTTCCATGAT
ATGACTTGGGTTGGAGTTGTAGGTATCCAAGACCCTCTTCGCCCCGAAGTCCCATCGGCCATTCGCAAATGTCAC
TCGGCAGGCGTCCAGGTCAAGATGGTGACTGGTGACAACGTTGCCACTGCCACTGCTATTGCAACTTCTTGCGGA
ATCAAGACGGAAGATGGATTGGTCATGGAAGGTCCCAAGTTCCGCCAACTCACAAACGAGGAGATGGATGAAGTG
GTTCCGCGCCTGCAAGTGCTGGCACGATCATCCCCCGAAGACAAGCGAATCTTGGTCGAACGTCTCAAGGCCCTC
GGTGAAACGGTCGCCGTGACAGGTGATGGTACCAACGACGGACCGGCTTTGCGGACTGCAGATGTCGGCTTCTCC
ATGGGTATTGCTGGTACTGAGGTCGCGAAGGAGGCGAGTTCGATTATTCTCCTGGATGATAATTTCAAGTCCATC
ATCACAGCGATCGCTTGGGGACGAGCTGTTAATGACGCCGTTGCCAAGTTTTTGCAATTCCAGGTCACGGTCAAT
ATCACGGCCGTGATCCTCACTTTTGTGTCATCTGTGTACAGCAGCGAGAACACCAGTGTTTTGACAGCTGTGCAG
CTGCTCTGGGTGAACCTGATCATGGACACATTCGCCGCTCTCGCCTTAGCCACGGATGCCCCGACTGAAAAGATT
CTCGACCGCAAGCCTGTCTCCAAACACGCCTCCCTTTTCACAATGACCATGTGGAAGATGATTCTTGGCCAAGCA
GTATACCAGCTAGCCATCACATTCATGCTTTATTTCGCAGGCGAAAAGCTCCTCAACGCCCATCTCAGCTCCGAG
CCCGAGATGCGCGCGAAACAACTCTCGACCGTGGTGTTCAACACGTTCGTGTGGATGCAGATCTTCAACGAATTC
AACAATCGCCGCCTCGACAACAAGTTCAATATCTTCGAAGGCATGTTCCGCAATTACTGGTTCTTAGGAATCAAC
GCCATCATGATCGGTGGCCAGGTCATGATCGTCTTCGTGGGCGGCCAGGCATTCAACGTGACTCGCTTGAACGGC
ACCCTCTGGGGCGTGTGTTTGATCTGTTCTATTGCCTGCTTGCCCTGGGCTATCGTGCTCCGACTTATCCCAGAC
TACTATTTCGGGCTTGTTTTCAATGCCGTTGTTGGCGGTATGGCTGTTGTTTTGCGCCCGCTTTCCAAGGGGTGC
AAGGTAATCGGTCGAGGCATCAGGTCTTTCTTTAGGCCTGTGAAGCGTTTCACTCGCCGTATTTTCAACAAGCGG
AAGTCAGAAGATGAACTCGAGTTGAAACCAAAGTCTACTGATCCTGAAGAAGCTCCTGAGAGACTACAACTGAAC
ACGCAAAAGCCCTCTCCTGAGCGTCTGGCCACGCCTACTCCTGTCGTCATTCCCCCTATCACGATTACTACGTCT
CCTTAG
Gene >Pro_DTO377G3_2|g2709.t1
ATGTCTTCTTCAAACAATGACCCCTCCTATCAGGGCTCGCTATTGAGTCCTGTTATAGTGACGGACTTTTCAGGC
AGAGAGGTAGGCCACTCAAGCTATTTCATCATTCTATAAACATCTGGAAATTTGTCGCTAATTGTTTTATTTTCT
TTCTCTTCCAGCGATCTATGTCTACAGCCTCTTCTGCATGGTCGGGTCCTACAGATCTAAATCACAGCCCGACTT
CTCCTGTCTCACCAGATATGGCGTGGAACCCACCAGACCCAGCTCGGCTGATGGTTCAAAATGCCTCGCATCGAC
TGTCACAGTCGATCGATGGCGATACATTGCGTCCGCGGGCGGATTCATTCGCTTCTTCAGCAGATACCGTAGTTC
GTTCGCGGGCGAACTCCGAGGTAGACCCGACCCATACTTCCAAAGATGTCTACGACGATGTCTCGCTGTCGGATG
CTTTGAAACCGGACCCGAGGAATGAAGCCGATTTCCAGGTGGAGGATAATCGGTTTGCGTTCTCCCCGGGTCAAC
TGAACAAAATGCAGAACCCAAAGTCCTTGGCTGCATTCCATGCTCTTGGTGGCTTACAAGGTCTGGAGCGGGGTC
TGCGAACAGATCTCAAGGCCGGTTTGTCAATTGATGAAGGGTGTCTGGAGGGCAATGTCGAGTTCCAGGATGTGG
CACCTTCAGCGCAACACACAGCTACAGAAAAATCTCCATCAAAACCTGTCACCTCGGCGCCGGCGCCGGTGTCAT
CTGGTCATGGTTCACCATTCGAAGACCGCATTCGTGTCTTCAGTCAGAACAAACTACCTGCTCGGAAATCGACCG
GGTTCCTGAAATTATTTTGGGCTGCATATAATGACAAAATTATTATATTATTGACCATTGCCGCCGTGGTCTCGC
TATCCCTGGGGATATACGAGACCGTGTCGGAAGGCACAGGCGTCCAGTGGGTGGAAGGAGTCGCCATCTGTGTAG
CAATCTTGATTGTTACAATCGTTACAGCTGCGAACGATTGGCAAAAAGAGAGACAATTTGCCAAGCTCAATAAAC
GGGCAGGTCTTCCCCTATCAATCCAGAAACTGAGCACAGCTAACATGCCAACAGAACGATGACCGTCAAGTTCAA
GTCACCCGCTCAGGCAAACCCGACATGGTTTCAATCTACGATATTATGGTCGGCGATATCCTCCATCTCGAGGCA
GGCGATTCCATCCCAGCAGATGGAATTCTAGTTTCAGGCTACGGGGTGAAGTGCGATGAGTCTTCCGCCACCGGC
GAGTCGGATCAAATGAAGAAGACCCCTGGCCATGAAGTCTGGCAGCAAATTGTCGACGGCAAGGCAACCAAGAAA
CTCGACCCGTTTCTGATCTCCGGTAGCAAGGTCCTTGAAGGGTTGGGAACTTATGTTGTCACCAGTGTTGGACCC
TATTCTACCTACGGACGGATCTTGTTGTCGCTGCAGACTCCTAATGACCCAACGCCGCTTCAAGTCAAGCTGGGT
AAGTTGGCGGATTGGATTGGGTATTTGGGTACAGCGTGAGTTGACTTTCATACTTCCCTTTTGTTGTACAGGTTA
CTGATGGTGAGACAGAGCTGCTGGTATTCTGTTCTTTGTTTTGCTATTCCGCTTTGTAGCCGATCTGCCCAATCA
CCCGGAAAGGAACGGTGCTGTGAAAGGCAAAGAGTTTGTGGATATTCTTATTGTTGCTGTCACGGTTATTGTTGT
CGCTATTCCAGGTAAGTGCTGATGTCTACAATCATCTGAGCCCTGCTGACATCCATGTTCTTCGCTAGAGGGTCT
CCCACTAGCAGTAACGCTGGCTTTGGCCTTCGCTACTACCCGTATGGTCAAGGAGAACAACCTAGTCCGCGTCCT
TCGCGCATGCGAGACAATGGGAAACGCCACGGTCATCTGCTCTGATAAAACAGGCACATTGACACAGAACAAAAT
GACCGTTGTGGCCGGAACCTGGGGCTCGAACCAAAACTTCAGCCAGAGAACCGAAGATGAAGATGTGGAAGGTTC
AATGACTACTTCGGCCATCTCCCAGAAACTATCAGCTCCCATCAAAGATTTGATTATCAAGAGCATCGCTTTGAA
CTCAACTGCGTTTGAACGGGAAAAGGACGGCTCCATCGATTTTGTCGGTAGTAAGACCGAGGTTGCGATGCTTCA
GTTGGCTAGGGATTATATGGGCATGGATCTTGTCTCGGAGCGTGGCTCCGCTGAGATCACCCAATTGATTCCTTT
CGACTCCGACAGGAAGTGCATGGGTGTTGTTTACCGTGTTCCTGGAGCTGGCTACCGACTGCTTGTCAAGGGAGC
GTCCGAGTTGATGGTCGGCGTCTGCACCGCAGAAATTGTCAACATTGATATTTCCAAAGAGAGACCCGATGTGGA
GCAGCTTTCTGACGAACAAAAGAAAAACCTTCTGGAGATCATCGACAATTATGCCCACAAGTCTCTTCGAACGAT
TGGCATAGTCTACAAGGACTTCGCAAGCTGGCCACCGATCGAAGCCAAACATTCTGAGGATCCTTCAGCAAACTT
CGAGGATTTCTTCCATGATATGACTTGGGTTGGAGTTGTAGGTATCCAAGACCCTCTTCGCCCCGAAGTCCCATC
GGCCATTCGCAAATGTCACTCGGCAGGCGTCCAGGTCAAGATGGTGACTGGTGACAACGTTGCCACTGCCACTGC
TATTGCAACTTCTTGCGGAATCAAGACGGAAGATGGATTGGTCATGGAAGGTCCCAAGTTCCGCCAACTCACAAA
CGAGGAGATGGATGAAGTGGTTCCGCGCCTGCAAGTGCTGGCACGATCATCCCCCGAAGACAAGCGAATCTTGGT
CGAACGTCTCAAGGCCCTCGGTGAAACGGTCGCCGTGACAGGTGATGGTACCAACGACGGACCGGCTTTGCGGAC
TGCAGATGTCGGCTTCTCCATGGGTATTGCTGGTACTGAGGTCGCGAAGGAGGCGAGTTCGATTATTCTCCTGGA
TGATAATTTCAAGTCCATCATCACAGCGATCGCTTGGGGACGAGCTGTTAATGACGCCGTTGCCAAGTTTTTGCA
ATTCCAGGTCACGGTCAATATCACGGCCGTGATCCTCACTTTTGTGTCATCTGTGTACAGCAGCGAGAACACCAG
TGTTTTGACAGCTGTGCAGCTGCTCTGGGTGAACCTGATCATGGACACATTCGCCGCTCTCGCCTTGTAAGTTGT
CGTGTTTTTCCTCTTATATTTCCCCTGGACCTCTCGCTAATGTTTTGGAAAATCAGAGCCACGGATGCCCCGACT
GAAAAGATTCTCGACCGCAAGCCTGTCTCCAAACACGCCTCCCTTTTCACAATGACCATGTGGAAGATGATTCTT
GGCCAAGCAGTATACCAGCTAGCCATCACATTCATGCTTTATTTCGCAGGCGAAAAGCTCCTCAACGCCCATCTC
AGCTCCGAGCCCGAGATGCGCGCGAAACAACTCTCGACCGTGGTGTTCAACACGTTCGTGTGGATGCAGATCTTC
AACGAATTCAACAATCGCCGCCTCGACAACAAGTTCAATATCTTCGAAGGCATGTTCCGCAATTACTGGTTCTTA
GGAATCAACGCCATCATGATCGGTGGCCAGGTCATGATCGTCTTCGTGGGCGGCCAGGCATTCAACGTGACTCGC
TTGAACGGCACCCTCTGGGGCGTGTGTTTGATCTGTTCTATTGCCTGCTTGCCCTGGGCTATCGTGCTCCGACTT
ATCCCAGACTACTATTTCGGGCTTGTTTTCAATGCCGTTGTTGGCGGTATGGCTGTTGTTTTGCGCCCGCTTTCC
AAGGGGTGCAAGGTAATCGGTCGAGGCATCAGGTCTTTCTTTAGGCCTGTGAAGCGTTTCACTCGCCGTATTTTC
AACAAGCGGAAGTCAGAAGATGAACTCGAGTTGAAACCAAAGTCTACTGATCCTGAAGAAGCTCCTGAGAGACTA
CAACTGAACACGCAAAAGCCCTCTCCTGAGCGTCTGGCCACGCCTACTCCTGTCGTCATTCCCCCTATCACGATT
ACTACGTCTCCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail