Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2692.t1
Gene name
Locationscaffold_03:695409..699240
Strand+
Gene length (bp)3831
Transcript length (bp)3831
Coding sequence length (bp)3831
Protein length (aa) 1277

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 4.6E-75 14 413
PF07993 NAD_binding_4 Male sterility protein 6.9E-61 649 891
PF00106 adh_short short chain dehydrogenase 2.7E-51 1036 1226
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 7.9E-38 1042 1255
PF08659 KR KR domain 1.8E-14 1039 1213
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.1E-08 647 851
PF00550 PP-binding Phosphopantetheine attachment site 3.8E-12 537 596

GO

GO Term Description Terminal node
GO:0050662 coenzyme binding Yes
GO:0003824 catalytic activity Yes
GO:0005488 binding No
GO:0048037 cofactor binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2692.t1
MAILDITKDLPTLFKRQVQATPDAIALEDETTTYTYTQLDEEVEALASRLRTYGVSRDTLVGVLLPRSAHYVIAC
LAALRAGGAFLVLELAYPADLLADVIEDASPAVIITHKSETDKIKAPVPVIALDGPIAEINGHAKEPSPLPADDD
LDRLAFVSYSSGTTGKPKGIANPHRAPVLSYDLRFAVQDVQPGDRVACNVFFIWEMLRPLLRGATVVIVPDETSY
DPAALVDLLSAKKVTETLMTPTLLATVLSRYPRFGTRVPDLRIIWLNGEVVTTDLARKAIKIIPNARLLNCYSAC
ETHEIACGDIREMVDGDSIYCPVGPSIVPAHTYVLNEDGQEVETGTSGELFIGGPLLAREYINLPETTAKAFLPD
TFDSTPGARMYRTGDLARKLPSGFLEITGRVGAMIKLRGYSVVPAKVESDICQYLAVSQCVVTAYGDGLERQLVA
YVVADKEASSDRPSVVINESGHSPSSRRVLENRLAQYMIPALWVALDQLPTNEVSGKVDMKNLPSPRSSSPNGSE
KSTGKDPIGLHDIAAIWEAVLKVSKSLIKAEDNFFDLGGHSLSLADLSSKLSRRFGFRVPIPRLAENTTLSGHLE
TVRAVRDGHTEEVQANLPAVLLSDSTLDEDIKPTNTAFTSISSAETVLLTGVTGFLGAFLLNDLIENTSAKIICL
VRFSDPEQDDQAGGVARIRRNLLDMGLWRDSILERLEILPGNLSRPRLGLSPEEFDNIAARVQVIVHAAATVNLV
YPYAALRGANVGGTREILRLAAKGGATVQYISTNGVLPPSGEKGWPETTILDIEDVPKKLLDGYGQTKWVAEQLV
LKAGERGLPVKIHRCGTISGHSVTGSANAWDLLTALIVESIQLGYAPEVDGWRAEMTPVNFVSKSIVHLATLTQA
DQTVFHLGDPTPVDTRSVFEDLKELGYETKPLPWDQWVALWFEKRGSAKGGDGSFTVDILRSGMPTVEFLRDIVV
LDNALTRPFRAVIERPKVDSLLLETYTRHWFARGWLPRPPSRQNALNRPNGVSVKGPLSGQVAVVTGASSGIGAA
VAAALAKQGCAVALGARRLDALESTKRKVEVHGVKCILRSTDVTSKTQVEALVQAASEELGPVDILVACAGVMYF
TMMANTQTDEWERTVDVNCKGLLHALSSTVPSMLSRGRGHIVAISSDAGRKVFPGLGVYSASKFFVEATLQALRL
ETAGAGLRVTSIQPGNTSTDLLGMSTDAEAVKKFGEPSGAKILDPSDVANSIVYALTQPEHVSVNEILVEPRDEP
I*
Coding >Pro_DTO377G3_2|g2692.t1
ATGGCCATCCTCGATATCACTAAGGATTTGCCCACACTATTTAAGCGACAGGTACAGGCAACCCCAGATGCCATC
GCTCTGGAAGACGAGACCACGACATATACATATACCCAGCTGGATGAAGAGGTTGAGGCTCTTGCCAGTCGCTTA
CGGACCTATGGAGTGAGCCGGGACACCCTCGTGGGTGTGCTCCTACCTCGCAGCGCACATTACGTGATTGCCTGT
CTGGCAGCGCTCCGTGCGGGTGGTGCGTTCCTTGTTCTCGAATTGGCTTACCCCGCGGACCTCTTGGCGGATGTT
ATCGAGGACGCTAGCCCCGCCGTGATTATCACCCACAAATCTGAGACCGACAAAATCAAGGCGCCCGTCCCCGTA
ATTGCCTTGGATGGACCCATTGCCGAGATCAATGGACACGCCAAGGAACCTTCTCCGTTGCCCGCAGATGACGAT
TTGGACCGTTTGGCGTTTGTGTCCTATTCGTCAGGCACAACAGGCAAGCCGAAAGGAATCGCCAATCCACACCGC
GCCCCGGTACTATCATACGATTTGAGATTTGCAGTGCAGGACGTACAACCGGGCGATCGAGTGGCCTGCAATGTC
TTCTTCATCTGGGAGATGCTGCGGCCGCTACTGCGCGGAGCTACCGTGGTTATCGTGCCCGATGAAACGAGCTAT
GACCCCGCAGCTCTGGTTGACCTGCTCTCGGCTAAGAAGGTCACTGAAACCCTCATGACACCCACACTCCTGGCT
ACCGTTCTTTCACGCTATCCCCGGTTCGGTACTCGTGTGCCTGATTTACGCATCATCTGGCTGAACGGTGAGGTG
GTGACAACCGATCTTGCCCGCAAGGCCATCAAAATTATTCCTAATGCCCGCTTGCTTAACTGCTACAGTGCGTGT
GAAACGCATGAGATTGCCTGCGGAGATATCCGTGAGATGGTTGATGGCGACTCCATTTACTGCCCAGTCGGCCCA
TCGATTGTTCCTGCACACACCTACGTTCTAAACGAGGATGGACAGGAGGTGGAGACGGGCACATCGGGAGAACTC
TTCATTGGAGGTCCTTTGTTGGCCCGCGAGTACATTAACCTTCCCGAGACCACTGCAAAGGCTTTCCTTCCAGAC
ACCTTTGATTCCACACCCGGTGCTCGTATGTACAGAACGGGCGATCTAGCCCGCAAGCTGCCTTCCGGATTCCTC
GAGATCACCGGCCGCGTCGGCGCAATGATCAAGCTGCGCGGATATTCGGTTGTGCCGGCAAAGGTCGAAAGTGAC
ATCTGCCAATACTTGGCTGTTAGTCAGTGCGTTGTCACTGCGTACGGCGATGGACTGGAACGACAACTGGTCGCA
TATGTTGTTGCCGATAAGGAGGCTTCCTCCGATCGCCCTTCGGTCGTGATCAACGAGTCCGGCCACTCCCCCAGC
TCGCGTCGTGTCCTCGAGAACCGTCTTGCCCAATACATGATCCCAGCTCTCTGGGTTGCACTAGACCAGTTGCCT
ACTAACGAGGTCTCTGGCAAGGTTGATATGAAAAATCTCCCTTCGCCTCGTAGCTCTAGTCCCAATGGCAGCGAG
AAAAGCACAGGAAAAGACCCGATCGGTCTCCATGACATTGCGGCAATCTGGGAGGCTGTTCTGAAAGTCTCAAAG
AGCCTGATTAAGGCCGAAGATAATTTCTTTGATCTGGGTGGACATTCCTTGTCTCTGGCTGATCTGTCATCCAAG
CTTTCCAGACGTTTCGGCTTCCGTGTTCCTATTCCTCGTCTTGCGGAGAACACTACTCTTTCCGGCCACTTGGAG
ACTGTGCGTGCTGTCAGAGATGGCCACACTGAAGAAGTGCAAGCAAATCTGCCCGCTGTCTTGCTTTCCGATTCC
ACACTGGACGAGGACATTAAGCCCACGAATACTGCGTTCACTTCAATCAGCTCGGCTGAGACGGTGCTTCTGACT
GGTGTGACTGGTTTCCTGGGCGCTTTCTTGCTCAATGATCTGATTGAGAACACCTCTGCTAAAATCATCTGTCTT
GTGCGTTTCAGCGACCCCGAGCAGGATGATCAAGCCGGAGGTGTGGCCCGAATCCGCAGGAACCTCCTAGATATG
GGACTCTGGCGCGATTCTATCCTGGAGCGTCTCGAAATCTTACCAGGAAACCTTTCCCGGCCTCGACTGGGCCTG
AGTCCGGAGGAATTTGACAACATCGCGGCTCGTGTCCAAGTAATTGTTCATGCTGCAGCCACTGTCAACCTTGTT
TACCCCTACGCTGCACTTCGGGGAGCGAACGTTGGTGGAACCAGAGAGATTCTGCGTCTCGCCGCTAAGGGTGGC
GCGACCGTGCAGTATATCTCTACCAATGGTGTCTTGCCCCCATCTGGCGAGAAAGGCTGGCCCGAGACTACTATA
CTAGATATAGAAGATGTCCCCAAAAAGCTACTCGATGGCTATGGCCAGACAAAGTGGGTTGCAGAGCAGCTCGTT
CTCAAGGCTGGTGAGCGTGGATTGCCAGTCAAAATTCACCGGTGCGGTACCATCAGTGGTCACAGTGTCACAGGC
TCCGCTAATGCGTGGGATTTGCTCACTGCATTGATTGTGGAATCCATCCAGCTTGGATACGCCCCAGAGGTGGAC
GGATGGCGTGCCGAGATGACCCCTGTGAACTTTGTCAGCAAATCCATTGTGCACCTTGCCACTCTGACCCAGGCA
GACCAAACGGTGTTCCATCTCGGAGACCCTACGCCGGTCGATACTCGGTCGGTCTTTGAGGACCTTAAAGAGCTT
GGTTATGAGACGAAACCTCTCCCATGGGATCAATGGGTGGCCTTGTGGTTCGAGAAGAGAGGCTCGGCCAAGGGT
GGTGATGGTTCGTTTACCGTCGATATTCTTCGCAGTGGCATGCCGACTGTCGAGTTCCTCCGAGATATCGTGGTC
CTTGATAACGCTTTGACCAGGCCTTTCCGGGCCGTTATCGAGCGTCCCAAGGTGGACAGCCTGTTGCTGGAGACC
TACACTCGGCACTGGTTTGCGCGAGGATGGCTACCCCGGCCCCCATCTCGTCAGAATGCCCTCAACCGACCCAAC
GGGGTTTCAGTGAAGGGGCCACTCAGCGGTCAAGTCGCCGTGGTGACTGGTGCTTCTTCAGGCATCGGTGCGGCG
GTAGCAGCCGCCCTAGCCAAGCAGGGTTGTGCTGTAGCACTTGGCGCTCGACGCCTGGATGCTCTTGAGAGCACC
AAGCGCAAGGTCGAAGTCCACGGCGTGAAGTGTATCCTCCGATCAACCGACGTCACAAGCAAGACTCAGGTGGAA
GCTCTCGTTCAAGCAGCAAGTGAGGAGCTCGGACCAGTGGATATCTTGGTTGCATGCGCTGGTGTCATGTACTTC
ACCATGATGGCAAACACGCAGACGGACGAGTGGGAGCGCACAGTCGACGTCAACTGCAAGGGCCTTTTGCACGCT
CTTTCGTCAACAGTGCCTAGCATGCTCTCGCGCGGCCGCGGCCATATTGTCGCCATCTCCTCCGATGCCGGACGA
AAGGTCTTCCCTGGTCTAGGTGTGTACTCGGCTAGCAAGTTCTTCGTCGAGGCCACCCTCCAAGCCCTCCGCCTC
GAGACTGCAGGCGCTGGCTTGCGCGTGACGAGTATCCAGCCCGGCAACACCTCCACTGACCTACTGGGCATGTCG
ACGGACGCTGAAGCCGTCAAGAAATTCGGAGAGCCATCCGGAGCCAAGATCCTCGATCCTTCGGATGTTGCCAAC
TCCATTGTTTACGCCCTGACGCAACCTGAGCATGTCTCCGTCAACGAGATCCTTGTTGAGCCTCGTGACGAGCCT
ATTTAA
Transcript >Pro_DTO377G3_2|g2692.t1
ATGGCCATCCTCGATATCACTAAGGATTTGCCCACACTATTTAAGCGACAGGTACAGGCAACCCCAGATGCCATC
GCTCTGGAAGACGAGACCACGACATATACATATACCCAGCTGGATGAAGAGGTTGAGGCTCTTGCCAGTCGCTTA
CGGACCTATGGAGTGAGCCGGGACACCCTCGTGGGTGTGCTCCTACCTCGCAGCGCACATTACGTGATTGCCTGT
CTGGCAGCGCTCCGTGCGGGTGGTGCGTTCCTTGTTCTCGAATTGGCTTACCCCGCGGACCTCTTGGCGGATGTT
ATCGAGGACGCTAGCCCCGCCGTGATTATCACCCACAAATCTGAGACCGACAAAATCAAGGCGCCCGTCCCCGTA
ATTGCCTTGGATGGACCCATTGCCGAGATCAATGGACACGCCAAGGAACCTTCTCCGTTGCCCGCAGATGACGAT
TTGGACCGTTTGGCGTTTGTGTCCTATTCGTCAGGCACAACAGGCAAGCCGAAAGGAATCGCCAATCCACACCGC
GCCCCGGTACTATCATACGATTTGAGATTTGCAGTGCAGGACGTACAACCGGGCGATCGAGTGGCCTGCAATGTC
TTCTTCATCTGGGAGATGCTGCGGCCGCTACTGCGCGGAGCTACCGTGGTTATCGTGCCCGATGAAACGAGCTAT
GACCCCGCAGCTCTGGTTGACCTGCTCTCGGCTAAGAAGGTCACTGAAACCCTCATGACACCCACACTCCTGGCT
ACCGTTCTTTCACGCTATCCCCGGTTCGGTACTCGTGTGCCTGATTTACGCATCATCTGGCTGAACGGTGAGGTG
GTGACAACCGATCTTGCCCGCAAGGCCATCAAAATTATTCCTAATGCCCGCTTGCTTAACTGCTACAGTGCGTGT
GAAACGCATGAGATTGCCTGCGGAGATATCCGTGAGATGGTTGATGGCGACTCCATTTACTGCCCAGTCGGCCCA
TCGATTGTTCCTGCACACACCTACGTTCTAAACGAGGATGGACAGGAGGTGGAGACGGGCACATCGGGAGAACTC
TTCATTGGAGGTCCTTTGTTGGCCCGCGAGTACATTAACCTTCCCGAGACCACTGCAAAGGCTTTCCTTCCAGAC
ACCTTTGATTCCACACCCGGTGCTCGTATGTACAGAACGGGCGATCTAGCCCGCAAGCTGCCTTCCGGATTCCTC
GAGATCACCGGCCGCGTCGGCGCAATGATCAAGCTGCGCGGATATTCGGTTGTGCCGGCAAAGGTCGAAAGTGAC
ATCTGCCAATACTTGGCTGTTAGTCAGTGCGTTGTCACTGCGTACGGCGATGGACTGGAACGACAACTGGTCGCA
TATGTTGTTGCCGATAAGGAGGCTTCCTCCGATCGCCCTTCGGTCGTGATCAACGAGTCCGGCCACTCCCCCAGC
TCGCGTCGTGTCCTCGAGAACCGTCTTGCCCAATACATGATCCCAGCTCTCTGGGTTGCACTAGACCAGTTGCCT
ACTAACGAGGTCTCTGGCAAGGTTGATATGAAAAATCTCCCTTCGCCTCGTAGCTCTAGTCCCAATGGCAGCGAG
AAAAGCACAGGAAAAGACCCGATCGGTCTCCATGACATTGCGGCAATCTGGGAGGCTGTTCTGAAAGTCTCAAAG
AGCCTGATTAAGGCCGAAGATAATTTCTTTGATCTGGGTGGACATTCCTTGTCTCTGGCTGATCTGTCATCCAAG
CTTTCCAGACGTTTCGGCTTCCGTGTTCCTATTCCTCGTCTTGCGGAGAACACTACTCTTTCCGGCCACTTGGAG
ACTGTGCGTGCTGTCAGAGATGGCCACACTGAAGAAGTGCAAGCAAATCTGCCCGCTGTCTTGCTTTCCGATTCC
ACACTGGACGAGGACATTAAGCCCACGAATACTGCGTTCACTTCAATCAGCTCGGCTGAGACGGTGCTTCTGACT
GGTGTGACTGGTTTCCTGGGCGCTTTCTTGCTCAATGATCTGATTGAGAACACCTCTGCTAAAATCATCTGTCTT
GTGCGTTTCAGCGACCCCGAGCAGGATGATCAAGCCGGAGGTGTGGCCCGAATCCGCAGGAACCTCCTAGATATG
GGACTCTGGCGCGATTCTATCCTGGAGCGTCTCGAAATCTTACCAGGAAACCTTTCCCGGCCTCGACTGGGCCTG
AGTCCGGAGGAATTTGACAACATCGCGGCTCGTGTCCAAGTAATTGTTCATGCTGCAGCCACTGTCAACCTTGTT
TACCCCTACGCTGCACTTCGGGGAGCGAACGTTGGTGGAACCAGAGAGATTCTGCGTCTCGCCGCTAAGGGTGGC
GCGACCGTGCAGTATATCTCTACCAATGGTGTCTTGCCCCCATCTGGCGAGAAAGGCTGGCCCGAGACTACTATA
CTAGATATAGAAGATGTCCCCAAAAAGCTACTCGATGGCTATGGCCAGACAAAGTGGGTTGCAGAGCAGCTCGTT
CTCAAGGCTGGTGAGCGTGGATTGCCAGTCAAAATTCACCGGTGCGGTACCATCAGTGGTCACAGTGTCACAGGC
TCCGCTAATGCGTGGGATTTGCTCACTGCATTGATTGTGGAATCCATCCAGCTTGGATACGCCCCAGAGGTGGAC
GGATGGCGTGCCGAGATGACCCCTGTGAACTTTGTCAGCAAATCCATTGTGCACCTTGCCACTCTGACCCAGGCA
GACCAAACGGTGTTCCATCTCGGAGACCCTACGCCGGTCGATACTCGGTCGGTCTTTGAGGACCTTAAAGAGCTT
GGTTATGAGACGAAACCTCTCCCATGGGATCAATGGGTGGCCTTGTGGTTCGAGAAGAGAGGCTCGGCCAAGGGT
GGTGATGGTTCGTTTACCGTCGATATTCTTCGCAGTGGCATGCCGACTGTCGAGTTCCTCCGAGATATCGTGGTC
CTTGATAACGCTTTGACCAGGCCTTTCCGGGCCGTTATCGAGCGTCCCAAGGTGGACAGCCTGTTGCTGGAGACC
TACACTCGGCACTGGTTTGCGCGAGGATGGCTACCCCGGCCCCCATCTCGTCAGAATGCCCTCAACCGACCCAAC
GGGGTTTCAGTGAAGGGGCCACTCAGCGGTCAAGTCGCCGTGGTGACTGGTGCTTCTTCAGGCATCGGTGCGGCG
GTAGCAGCCGCCCTAGCCAAGCAGGGTTGTGCTGTAGCACTTGGCGCTCGACGCCTGGATGCTCTTGAGAGCACC
AAGCGCAAGGTCGAAGTCCACGGCGTGAAGTGTATCCTCCGATCAACCGACGTCACAAGCAAGACTCAGGTGGAA
GCTCTCGTTCAAGCAGCAAGTGAGGAGCTCGGACCAGTGGATATCTTGGTTGCATGCGCTGGTGTCATGTACTTC
ACCATGATGGCAAACACGCAGACGGACGAGTGGGAGCGCACAGTCGACGTCAACTGCAAGGGCCTTTTGCACGCT
CTTTCGTCAACAGTGCCTAGCATGCTCTCGCGCGGCCGCGGCCATATTGTCGCCATCTCCTCCGATGCCGGACGA
AAGGTCTTCCCTGGTCTAGGTGTGTACTCGGCTAGCAAGTTCTTCGTCGAGGCCACCCTCCAAGCCCTCCGCCTC
GAGACTGCAGGCGCTGGCTTGCGCGTGACGAGTATCCAGCCCGGCAACACCTCCACTGACCTACTGGGCATGTCG
ACGGACGCTGAAGCCGTCAAGAAATTCGGAGAGCCATCCGGAGCCAAGATCCTCGATCCTTCGGATGTTGCCAAC
TCCATTGTTTACGCCCTGACGCAACCTGAGCATGTCTCCGTCAACGAGATCCTTGTTGAGCCTCGTGACGAGCCT
ATTTAA
Gene >Pro_DTO377G3_2|g2692.t1
ATGGCCATCCTCGATATCACTAAGGATTTGCCCACACTATTTAAGCGACAGGTACAGGCAACCCCAGATGCCATC
GCTCTGGAAGACGAGACCACGACATATACATATACCCAGCTGGATGAAGAGGTTGAGGCTCTTGCCAGTCGCTTA
CGGACCTATGGAGTGAGCCGGGACACCCTCGTGGGTGTGCTCCTACCTCGCAGCGCACATTACGTGATTGCCTGT
CTGGCAGCGCTCCGTGCGGGTGGTGCGTTCCTTGTTCTCGAATTGGCTTACCCCGCGGACCTCTTGGCGGATGTT
ATCGAGGACGCTAGCCCCGCCGTGATTATCACCCACAAATCTGAGACCGACAAAATCAAGGCGCCCGTCCCCGTA
ATTGCCTTGGATGGACCCATTGCCGAGATCAATGGACACGCCAAGGAACCTTCTCCGTTGCCCGCAGATGACGAT
TTGGACCGTTTGGCGTTTGTGTCCTATTCGTCAGGCACAACAGGCAAGCCGAAAGGAATCGCCAATCCACACCGC
GCCCCGGTACTATCATACGATTTGAGATTTGCAGTGCAGGACGTACAACCGGGCGATCGAGTGGCCTGCAATGTC
TTCTTCATCTGGGAGATGCTGCGGCCGCTACTGCGCGGAGCTACCGTGGTTATCGTGCCCGATGAAACGAGCTAT
GACCCCGCAGCTCTGGTTGACCTGCTCTCGGCTAAGAAGGTCACTGAAACCCTCATGACACCCACACTCCTGGCT
ACCGTTCTTTCACGCTATCCCCGGTTCGGTACTCGTGTGCCTGATTTACGCATCATCTGGCTGAACGGTGAGGTG
GTGACAACCGATCTTGCCCGCAAGGCCATCAAAATTATTCCTAATGCCCGCTTGCTTAACTGCTACAGTGCGTGT
GAAACGCATGAGATTGCCTGCGGAGATATCCGTGAGATGGTTGATGGCGACTCCATTTACTGCCCAGTCGGCCCA
TCGATTGTTCCTGCACACACCTACGTTCTAAACGAGGATGGACAGGAGGTGGAGACGGGCACATCGGGAGAACTC
TTCATTGGAGGTCCTTTGTTGGCCCGCGAGTACATTAACCTTCCCGAGACCACTGCAAAGGCTTTCCTTCCAGAC
ACCTTTGATTCCACACCCGGTGCTCGTATGTACAGAACGGGCGATCTAGCCCGCAAGCTGCCTTCCGGATTCCTC
GAGATCACCGGCCGCGTCGGCGCAATGATCAAGCTGCGCGGATATTCGGTTGTGCCGGCAAAGGTCGAAAGTGAC
ATCTGCCAATACTTGGCTGTTAGTCAGTGCGTTGTCACTGCGTACGGCGATGGACTGGAACGACAACTGGTCGCA
TATGTTGTTGCCGATAAGGAGGCTTCCTCCGATCGCCCTTCGGTCGTGATCAACGAGTCCGGCCACTCCCCCAGC
TCGCGTCGTGTCCTCGAGAACCGTCTTGCCCAATACATGATCCCAGCTCTCTGGGTTGCACTAGACCAGTTGCCT
ACTAACGAGGTCTCTGGCAAGGTTGATATGAAAAATCTCCCTTCGCCTCGTAGCTCTAGTCCCAATGGCAGCGAG
AAAAGCACAGGAAAAGACCCGATCGGTCTCCATGACATTGCGGCAATCTGGGAGGCTGTTCTGAAAGTCTCAAAG
AGCCTGATTAAGGCCGAAGATAATTTCTTTGATCTGGGTGGACATTCCTTGTCTCTGGCTGATCTGTCATCCAAG
CTTTCCAGACGTTTCGGCTTCCGTGTTCCTATTCCTCGTCTTGCGGAGAACACTACTCTTTCCGGCCACTTGGAG
ACTGTGCGTGCTGTCAGAGATGGCCACACTGAAGAAGTGCAAGCAAATCTGCCCGCTGTCTTGCTTTCCGATTCC
ACACTGGACGAGGACATTAAGCCCACGAATACTGCGTTCACTTCAATCAGCTCGGCTGAGACGGTGCTTCTGACT
GGTGTGACTGGTTTCCTGGGCGCTTTCTTGCTCAATGATCTGATTGAGAACACCTCTGCTAAAATCATCTGTCTT
GTGCGTTTCAGCGACCCCGAGCAGGATGATCAAGCCGGAGGTGTGGCCCGAATCCGCAGGAACCTCCTAGATATG
GGACTCTGGCGCGATTCTATCCTGGAGCGTCTCGAAATCTTACCAGGAAACCTTTCCCGGCCTCGACTGGGCCTG
AGTCCGGAGGAATTTGACAACATCGCGGCTCGTGTCCAAGTAATTGTTCATGCTGCAGCCACTGTCAACCTTGTT
TACCCCTACGCTGCACTTCGGGGAGCGAACGTTGGTGGAACCAGAGAGATTCTGCGTCTCGCCGCTAAGGGTGGC
GCGACCGTGCAGTATATCTCTACCAATGGTGTCTTGCCCCCATCTGGCGAGAAAGGCTGGCCCGAGACTACTATA
CTAGATATAGAAGATGTCCCCAAAAAGCTACTCGATGGCTATGGCCAGACAAAGTGGGTTGCAGAGCAGCTCGTT
CTCAAGGCTGGTGAGCGTGGATTGCCAGTCAAAATTCACCGGTGCGGTACCATCAGTGGTCACAGTGTCACAGGC
TCCGCTAATGCGTGGGATTTGCTCACTGCATTGATTGTGGAATCCATCCAGCTTGGATACGCCCCAGAGGTGGAC
GGATGGCGTGCCGAGATGACCCCTGTGAACTTTGTCAGCAAATCCATTGTGCACCTTGCCACTCTGACCCAGGCA
GACCAAACGGTGTTCCATCTCGGAGACCCTACGCCGGTCGATACTCGGTCGGTCTTTGAGGACCTTAAAGAGCTT
GGTTATGAGACGAAACCTCTCCCATGGGATCAATGGGTGGCCTTGTGGTTCGAGAAGAGAGGCTCGGCCAAGGGT
GGTGATGGTTCGTTTACCGTCGATATTCTTCGCAGTGGCATGCCGACTGTCGAGTTCCTCCGAGATATCGTGGTC
CTTGATAACGCTTTGACCAGGCCTTTCCGGGCCGTTATCGAGCGTCCCAAGGTGGACAGCCTGTTGCTGGAGACC
TACACTCGGCACTGGTTTGCGCGAGGATGGCTACCCCGGCCCCCATCTCGTCAGAATGCCCTCAACCGACCCAAC
GGGGTTTCAGTGAAGGGGCCACTCAGCGGTCAAGTCGCCGTGGTGACTGGTGCTTCTTCAGGCATCGGTGCGGCG
GTAGCAGCCGCCCTAGCCAAGCAGGGTTGTGCTGTAGCACTTGGCGCTCGACGCCTGGATGCTCTTGAGAGCACC
AAGCGCAAGGTCGAAGTCCACGGCGTGAAGTGTATCCTCCGATCAACCGACGTCACAAGCAAGACTCAGGTGGAA
GCTCTCGTTCAAGCAGCAAGTGAGGAGCTCGGACCAGTGGATATCTTGGTTGCATGCGCTGGTGTCATGTACTTC
ACCATGATGGCAAACACGCAGACGGACGAGTGGGAGCGCACAGTCGACGTCAACTGCAAGGGCCTTTTGCACGCT
CTTTCGTCAACAGTGCCTAGCATGCTCTCGCGCGGCCGCGGCCATATTGTCGCCATCTCCTCCGATGCCGGACGA
AAGGTCTTCCCTGGTCTAGGTGTGTACTCGGCTAGCAAGTTCTTCGTCGAGGCCACCCTCCAAGCCCTCCGCCTC
GAGACTGCAGGCGCTGGCTTGCGCGTGACGAGTATCCAGCCCGGCAACACCTCCACTGACCTACTGGGCATGTCG
ACGGACGCTGAAGCCGTCAAGAAATTCGGAGAGCCATCCGGAGCCAAGATCCTCGATCCTTCGGATGTTGCCAAC
TCCATTGTTTACGCCCTGACGCAACCTGAGCATGTCTCCGTCAACGAGATCCTTGTTGAGCCTCGTGACGAGCCT
ATTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail