Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2675.t1
Gene name
Locationscaffold_03:655328..657047
Strand-
Gene length (bp)1719
Transcript length (bp)1536
Coding sequence length (bp)1536
Protein length (aa) 512

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 1.7E-52 14 485
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.5E-14 9 67
PF01266 DAO FAD dependent oxidoreductase 6.8E-07 6 254

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 20.08 10.34 29.82
5d_25C Five days - 25 degrees Celsius 19.55 9.97 29.12
7d_25C Seven days - 25 degrees Celsius 19.97 10.21 29.73
10d_25C Ten days - 25 degrees Celsius 24.01 12.74 35.28
7d_15C Seven days - 15 degrees Celsius 16.52 7.98 25.06
7d_30C Seven days - 30 degrees Celsius 18.79 9.45 28.12

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.950496 no
3d_25C 7d_25C 0.989706 no
3d_25C 7d_15C 0.575185 no
3d_25C 7d_30C 0.870070 no
3d_25C 10d_25C 0.580760 no
5d_25C 7d_25C 0.961913 no
5d_25C 7d_15C 0.630119 no
5d_25C 7d_30C 0.928890 no
5d_25C 10d_25C 0.503789 no
7d_25C 7d_15C 0.579190 no
7d_25C 7d_30C 0.879833 no
7d_25C 10d_25C 0.558835 no
7d_15C 7d_30C 0.732018 no
7d_15C 10d_25C 0.190760 no
7d_30C 10d_25C 0.403793 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2675.t1
MAPSPHIGIIGAGISGLRCADILIQNGAQVTILEARDRIGGRVHQSTVGDHIVDIGPNWIHGAGENPIMTIAEET
GSVMYDPEGGAHISYSRDGHPINDEVSAKVQDFVWTTIAEAFKYSNHHGESIPVEQSLFDFFCDRVQQTKFSDEE
KQLCLDACRLWGAYVGDQVDRQSLKFFRLEECVDGSNFIVASTYKRILEHIAETATAKADIRLNEPVTSIKAPPH
NNQSPTKHRVTVTTATGTNYNFDDVVITCPLGWLKQNTSAFTPALPPRLEQAINNISYGRLEKVYVTFPRAFWHT
QNTSTSTTQTQTQNTVFAQFLEPSYYTHHPAHIEWNQECVSLASFPEPHAHPTLLFYTYGDSGAEIVNRISEQAP
SSPEYRESLIDVMQPFYSRLPGYSAENPDCVPVALLATQWQKDVFAGNGSYCNFQVGVEEADVDVEVLRSGDGIG
PVRGLWFAGEHTAPFVALGTTTGAFWSGERVARLVCQGLGIGEVGGMGVKDDSLPSAGDVS*
Coding >Pro_DTO377G3_2|g2675.t1
ATGGCTCCGAGTCCGCACATCGGCATCATCGGCGCAGGGATTTCAGGCCTCCGGTGCGCCGACATCCTCATCCAA
AATGGAGCCCAAGTAACAATCCTAGAAGCAAGAGATCGCATTGGTGGCAGAGTGCACCAATCAACAGTTGGAGAC
CATATCGTGGATATAGGCCCCAATTGGATTCATGGCGCGGGGGAGAACCCCATCATGACCATAGCGGAAGAAACG
GGGTCTGTCATGTATGATCCCGAAGGTGGAGCGCATATCTCCTACTCGCGAGACGGCCACCCTATCAACGACGAA
GTGAGCGCTAAAGTCCAGGACTTTGTATGGACCACTATAGCAGAAGCCTTCAAATACAGCAATCACCATGGAGAA
AGCATCCCCGTCGAGCAAAGTCTATTCGATTTCTTCTGCGATCGAGTCCAGCAAACCAAATTCTCAGATGAAGAG
AAACAGCTTTGTCTCGATGCCTGTAGGCTTTGGGGTGCATATGTCGGTGATCAAGTCGACAGGCAGAGCTTGAAA
TTTTTCCGTCTGGAGGAATGCGTGGACGGGAGCAACTTCATCGTGGCATCTACATACAAGCGCATTCTAGAGCAC
ATCGCCGAAACCGCCACTGCAAAAGCCGACATCCGCCTCAATGAACCTGTCACAAGCATCAAAGCACCACCTCAC
AACAACCAATCACCAACAAAGCACCGAGTAACCGTAACAACAGCCACAGGAACAAACTACAACTTCGACGACGTA
GTCATAACCTGCCCACTGGGCTGGCTCAAGCAAAACACCTCAGCATTCACACCGGCTCTCCCGCCCCGTCTCGAA
CAAGCAATCAACAACATCTCATACGGCCGACTGGAAAAAGTCTACGTGACATTCCCGCGTGCCTTCTGGCACACC
CAAAACACCAGCACCTCAACAACTCAAACGCAAACTCAGAATACCGTCTTCGCCCAATTCCTCGAACCATCCTAC
TACACCCACCACCCAGCACACATAGAATGGAACCAAGAATGCGTCTCGCTCGCCTCGTTCCCAGAACCACACGCC
CATCCCACCCTTCTCTTCTACACGTACGGCGACAGCGGCGCAGAGATAGTAAACCGCATTTCGGAGCAAGCGCCC
TCGTCGCCCGAATACAGGGAATCTCTAATCGACGTAATGCAGCCCTTTTACTCCCGGCTCCCCGGGTACAGCGCG
GAGAACCCGGATTGTGTGCCCGTGGCGCTTCTTGCTACGCAATGGCAGAAGGATGTCTTTGCTGGGAATGGGTCG
TATTGTAATTTCCAGGTTGGGGTTGAGGAGGCAGATGTGGATGTTGAGGTTCTTAGGTCTGGGGATGGGATTGGT
CCGGTTAGGGGTCTTTGGTTTGCTGGGGAGCATACGGCGCCGTTTGTTGCGCTTGGGACTACCACTGGTGCGTTC
TGGAGTGGGGAGAGGGTTGCGAGATTGGTTTGTCAGGGGCTTGGGATTGGGGAGGTTGGTGGGATGGGGGTTAAG
GATGATTCTTTGCCTTCTGCTGGGGATGTGTCTTGA
Transcript >Pro_DTO377G3_2|g2675.t1
ATGGCTCCGAGTCCGCACATCGGCATCATCGGCGCAGGGATTTCAGGCCTCCGGTGCGCCGACATCCTCATCCAA
AATGGAGCCCAAGTAACAATCCTAGAAGCAAGAGATCGCATTGGTGGCAGAGTGCACCAATCAACAGTTGGAGAC
CATATCGTGGATATAGGCCCCAATTGGATTCATGGCGCGGGGGAGAACCCCATCATGACCATAGCGGAAGAAACG
GGGTCTGTCATGTATGATCCCGAAGGTGGAGCGCATATCTCCTACTCGCGAGACGGCCACCCTATCAACGACGAA
GTGAGCGCTAAAGTCCAGGACTTTGTATGGACCACTATAGCAGAAGCCTTCAAATACAGCAATCACCATGGAGAA
AGCATCCCCGTCGAGCAAAGTCTATTCGATTTCTTCTGCGATCGAGTCCAGCAAACCAAATTCTCAGATGAAGAG
AAACAGCTTTGTCTCGATGCCTGTAGGCTTTGGGGTGCATATGTCGGTGATCAAGTCGACAGGCAGAGCTTGAAA
TTTTTCCGTCTGGAGGAATGCGTGGACGGGAGCAACTTCATCGTGGCATCTACATACAAGCGCATTCTAGAGCAC
ATCGCCGAAACCGCCACTGCAAAAGCCGACATCCGCCTCAATGAACCTGTCACAAGCATCAAAGCACCACCTCAC
AACAACCAATCACCAACAAAGCACCGAGTAACCGTAACAACAGCCACAGGAACAAACTACAACTTCGACGACGTA
GTCATAACCTGCCCACTGGGCTGGCTCAAGCAAAACACCTCAGCATTCACACCGGCTCTCCCGCCCCGTCTCGAA
CAAGCAATCAACAACATCTCATACGGCCGACTGGAAAAAGTCTACGTGACATTCCCGCGTGCCTTCTGGCACACC
CAAAACACCAGCACCTCAACAACTCAAACGCAAACTCAGAATACCGTCTTCGCCCAATTCCTCGAACCATCCTAC
TACACCCACCACCCAGCACACATAGAATGGAACCAAGAATGCGTCTCGCTCGCCTCGTTCCCAGAACCACACGCC
CATCCCACCCTTCTCTTCTACACGTACGGCGACAGCGGCGCAGAGATAGTAAACCGCATTTCGGAGCAAGCGCCC
TCGTCGCCCGAATACAGGGAATCTCTAATCGACGTAATGCAGCCCTTTTACTCCCGGCTCCCCGGGTACAGCGCG
GAGAACCCGGATTGTGTGCCCGTGGCGCTTCTTGCTACGCAATGGCAGAAGGATGTCTTTGCTGGGAATGGGTCG
TATTGTAATTTCCAGGTTGGGGTTGAGGAGGCAGATGTGGATGTTGAGGTTCTTAGGTCTGGGGATGGGATTGGT
CCGGTTAGGGGTCTTTGGTTTGCTGGGGAGCATACGGCGCCGTTTGTTGCGCTTGGGACTACCACTGGTGCGTTC
TGGAGTGGGGAGAGGGTTGCGAGATTGGTTTGTCAGGGGCTTGGGATTGGGGAGGTTGGTGGGATGGGGGTTAAG
GATGATTCTTTGCCTTCTGCTGGGGATGTGTCTTGA
Gene >Pro_DTO377G3_2|g2675.t1
ATGGCTCCGAGTCCGCACATCGGCATCATCGGCGCAGGGATTTCAGGCCTCCGGTGCGCCGACATCCTCATCCAA
AATGGAGCCCAAGTAACAATCCTAGAAGCAAGAGATCGCATTGGTGGCAGAGTATGTCTTCCTTATACCCGGCAC
AACTGCAAGAGGCCAAGTAGTTCTTTAACTTTCTTATCGGCTAGGTGCACCAATCAACAGTTGGAGACCATATCG
TGGATATGTATGTACACGTACATGACTATGACTTGGAAAGTATGCAGCTAATGCTCAAATCAGAGGCCCCAATTG
GATTCATGGCGCGGGGGAGAACCCCATCATGACCATAGCGGAAGAAACGGGGTCTGTCATGTATGATCCCGAAGG
TGGAGCGCATATCTCCTACTCGCGAGACGGCCACCCTATCAACGACGAAGTGAGCGCTAAAGTCCAGGACTTTGT
ATGGACCACTATAGCAGAAGCCTTCAAATACAGCAATCACCATGGAGAAAGCATCCCCGTCGAGCAAAGTCTATT
CGATTTCTTCTGCGATCGAGTCCAGCAAACCAAATTCTCAGATGAAGAGAAACAGCTTTGTCTCGATGCCTGTAG
GCTTTGGGGTGCATATGTCGGTGATCAAGTCGACAGGCAGAGCTTGAAATTTTTCCGTCTGGAGGAATGCGTGGA
CGGGAGTATGTACCTTTAGCAAAATAGCCCGGAGACGTATAGCAGAGTTTCTAACATCATCAAGGCAACTTCATC
GTGGCATCTACATACAAGCGCATTCTAGAGCACATCGCCGAAACCGCCACTGCAAAAGCCGACATCCGCCTCAAT
GAACCTGTCACAAGCATCAAAGCACCACCTCACAACAACCAATCACCAACAAAGCACCGAGTAACCGTAACAACA
GCCACAGGAACAAACTACAACTTCGACGACGTAGTCATAACCTGCCCACTGGGCTGGCTCAAGCAAAACACCTCA
GCATTCACACCGGCTCTCCCGCCCCGTCTCGAACAAGCAATCAACAACATCTCATACGGCCGACTGGAAAAAGTC
TACGTGACATTCCCGCGTGCCTTCTGGCACACCCAAAACACCAGCACCTCAACAACTCAAACGCAAACTCAGAAT
ACCGTCTTCGCCCAATTCCTCGAACCATCCTACTACACCCACCACCCAGCACACATAGAATGGAACCAAGAATGC
GTCTCGCTCGCCTCGTTCCCAGAACCACACGCCCATCCCACCCTTCTCTTCTACACGTACGGCGACAGCGGCGCA
GAGATAGTAAACCGCATTTCGGAGCAAGCGCCCTCGTCGCCCGAATACAGGGAATCTCTAATCGACGTAATGCAG
CCCTTTTACTCCCGGCTCCCCGGGTACAGCGCGGAGAACCCGGATTGTGTGCCCGTGGCGCTTCTTGCTACGCAA
TGGCAGAAGGATGTCTTTGCTGGGAATGGGTCGTATTGTAATTTCCAGGTTGGGGTTGAGGAGGCAGATGTGGAT
GTTGAGGTTCTTAGGTCTGGGGATGGGATTGGTCCGGTTAGGGGTCTTTGGTTTGCTGGGGAGCATACGGCGCCG
TTTGTTGCGCTTGGGACTACCACTGGTGCGTTCTGGAGTGGGGAGAGGGTTGCGAGATTGGTTTGTCAGGGGCTT
GGGATTGGGGAGGTTGGTGGGATGGGGGTTAAGGATGATTCTTTGCCTTCTGCTGGGGATGTGTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail