Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2671.t1
Gene name
Locationscaffold_03:644735..646729
Strand+
Gene length (bp)1994
Transcript length (bp)1614
Coding sequence length (bp)1614
Protein length (aa) 538

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 2.3E-80 16 481
PF07690 MFS_1 Major Facilitator Superfamily 4.2E-18 27 362

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 64 86 22
3 93 110 17
4 120 139 19
5 151 173 22
6 188 207 19
7 284 306 22
8 316 338 22
9 351 373 22
10 383 405 22
11 418 440 22
12 444 466 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 8.59 3.38 13.80
5d_25C Five days - 25 degrees Celsius 5.99 1.99 9.99
7d_25C Seven days - 25 degrees Celsius 11.40 4.77 18.03
10d_25C Ten days - 25 degrees Celsius 4.45 1.06 7.85
7d_15C Seven days - 15 degrees Celsius 5.75 1.08 10.43
7d_30C Seven days - 30 degrees Celsius 9.17 3.75 14.59

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.358632 no
3d_25C 7d_25C 0.455557 no
3d_25C 7d_15C 0.369388 no
3d_25C 7d_30C 0.896729 no
3d_25C 10d_25C 0.074414 no
5d_25C 7d_25C 0.059176 no
5d_25C 7d_15C 0.951481 no
5d_25C 7d_30C 0.243021 no
5d_25C 10d_25C 0.520588 no
7d_25C 7d_15C 0.091904 no
7d_25C 7d_30C 0.573334 no
7d_25C 10d_25C 0.008469 yes
7d_15C 7d_30C 0.262793 no
7d_15C 10d_25C 0.632307 no
7d_30C 10d_25C 0.043201 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2671.t1
MGRFGSQTSSYNRLVIVFVAVGSMTYGYCSSIISSTIGQPGWYAYFSLPAEGEPGYATITTPAISTANGVFSAGG
AVGTLFIMWSCDFFGRKANIQFGAFFSLFGGALQAGSNSLAMFQAGRFICGLGIGILVTVCPMYLSEMSSALRRG
WLVGHHAIFLVFGYMLSGWVGYACYYATGPLSGFGWRFPLALQCLPALVLLLGSPWLPRSPRWLISKGKLDEAQH
VLERLRESPDDPNNLAAKEEFFQTKEQIRLEAERLATYGSVWKAVFTRKTYRKRMAIGFLAQWGAEFGGPLIINN
YAVLLYKNLGMEGGMPLLLSAVWLTTAGVIYNPLGAWLHDKINSRRGMYMTGFVGIIVSTSCLAAMTAQYAGTTN
KVGNGFGIFFMYLYLAFQGTFCDTTMYLYVSEIFPTEIRPIGMGFSLFGQFAATLILLQTAPMGFGNVGWKYYLV
IICWSAFFIPVIYFFFPETAGLTLEEIAKNFGEEVAFDLTGATDEEKARLDHQLATDDVQSSVGSELEKETKPLS
TDGAEQHVPKAE*
Coding >Pro_DTO377G3_2|g2671.t1
ATGGGTAGGTTCGGGTCTCAGACCAGTTCCTATAACAGGCTGGTTATTGTTTTTGTGGCTGTTGGGTCAATGACA
TATGGATATTGCTCTTCGATTATCTCCAGTACAATCGGCCAGCCGGGATGGTATGCCTACTTTAGCCTGCCCGCC
GAGGGTGAACCGGGATACGCGACAATCACTACCCCCGCGATCTCGACAGCAAATGGTGTTTTCAGTGCTGGTGGT
GCTGTTGGTACACTTTTTATAATGTGGTCGTGTGATTTCTTTGGCCGAAAGGCAAACATCCAGTTCGGTGCCTTC
TTTTCTCTATTTGGAGGAGCACTTCAAGCCGGCTCGAATTCACTAGCTATGTTCCAAGCTGGTCGCTTCATTTGT
GGTCTTGGAATCGGTATCCTCGTAACCGTCTGCCCTATGTATCTTTCCGAGATGTCGAGTGCTCTGCGCCGTGGC
TGGCTTGTCGGCCACCACGCCATTTTCTTGGTCTTCGGATACATGCTTTCGGGATGGGTGGGGTATGCCTGCTAC
TATGCAACAGGCCCCCTGTCTGGGTTTGGCTGGAGATTCCCTCTCGCCTTGCAATGTCTGCCCGCGTTGGTGCTG
CTTCTGGGATCTCCTTGGCTCCCCCGTTCACCTCGTTGGTTGATTTCGAAGGGTAAGCTCGATGAGGCGCAGCAT
GTTCTCGAACGGCTCCGTGAATCACCAGATGACCCGAATAACTTGGCTGCCAAGGAAGAGTTCTTCCAGACAAAA
GAGCAAATCCGACTCGAGGCTGAGAGATTAGCTACTTACGGCAGCGTGTGGAAAGCTGTCTTTACAAGGAAAACA
TACCGAAAGCGAATGGCTATCGGTTTCCTTGCCCAATGGGGCGCTGAATTTGGCGGGCCTCTGATCATCAACAAT
TACGCTGTTCTTCTATACAAAAACTTGGGCATGGAGGGTGGCATGCCCCTGCTCTTGAGTGCTGTCTGGCTGACA
ACAGCTGGTGTCATCTACAATCCTCTGGGCGCCTGGCTCCATGATAAAATTAACTCCCGGCGCGGCATGTACATG
ACTGGCTTTGTCGGCATTATCGTATCTACATCCTGTCTGGCTGCTATGACCGCCCAGTATGCTGGTACAACAAAC
AAGGTCGGAAATGGATTTGGTATATTCTTCATGTACCTTTATCTGGCCTTCCAGGGTACTTTCTGTGATACCACC
ATGTATCTCTATGTCTCCGAGATCTTCCCGACTGAAATCCGACCAATTGGCATGGGCTTTTCTCTCTTCGGTCAA
TTTGCTGCCACCCTCATCCTCCTGCAAACTGCCCCCATGGGCTTCGGGAATGTCGGCTGGAAATATTATCTTGTC
ATTATTTGCTGGTCTGCATTCTTCATTCCCGTCATCTACTTCTTCTTCCCCGAGACTGCTGGTCTCACCCTAGAG
GAAATCGCCAAAAATTTCGGCGAGGAGGTTGCTTTTGACCTCACCGGCGCCACAGATGAGGAAAAAGCTCGGCTC
GACCACCAGCTAGCCACAGATGACGTTCAATCATCTGTGGGCTCGGAGCTAGAGAAGGAAACTAAGCCGTTGTCA
ACAGATGGGGCTGAGCAGCATGTGCCGAAAGCAGAATAA
Transcript >Pro_DTO377G3_2|g2671.t1
ATGGGTAGGTTCGGGTCTCAGACCAGTTCCTATAACAGGCTGGTTATTGTTTTTGTGGCTGTTGGGTCAATGACA
TATGGATATTGCTCTTCGATTATCTCCAGTACAATCGGCCAGCCGGGATGGTATGCCTACTTTAGCCTGCCCGCC
GAGGGTGAACCGGGATACGCGACAATCACTACCCCCGCGATCTCGACAGCAAATGGTGTTTTCAGTGCTGGTGGT
GCTGTTGGTACACTTTTTATAATGTGGTCGTGTGATTTCTTTGGCCGAAAGGCAAACATCCAGTTCGGTGCCTTC
TTTTCTCTATTTGGAGGAGCACTTCAAGCCGGCTCGAATTCACTAGCTATGTTCCAAGCTGGTCGCTTCATTTGT
GGTCTTGGAATCGGTATCCTCGTAACCGTCTGCCCTATGTATCTTTCCGAGATGTCGAGTGCTCTGCGCCGTGGC
TGGCTTGTCGGCCACCACGCCATTTTCTTGGTCTTCGGATACATGCTTTCGGGATGGGTGGGGTATGCCTGCTAC
TATGCAACAGGCCCCCTGTCTGGGTTTGGCTGGAGATTCCCTCTCGCCTTGCAATGTCTGCCCGCGTTGGTGCTG
CTTCTGGGATCTCCTTGGCTCCCCCGTTCACCTCGTTGGTTGATTTCGAAGGGTAAGCTCGATGAGGCGCAGCAT
GTTCTCGAACGGCTCCGTGAATCACCAGATGACCCGAATAACTTGGCTGCCAAGGAAGAGTTCTTCCAGACAAAA
GAGCAAATCCGACTCGAGGCTGAGAGATTAGCTACTTACGGCAGCGTGTGGAAAGCTGTCTTTACAAGGAAAACA
TACCGAAAGCGAATGGCTATCGGTTTCCTTGCCCAATGGGGCGCTGAATTTGGCGGGCCTCTGATCATCAACAAT
TACGCTGTTCTTCTATACAAAAACTTGGGCATGGAGGGTGGCATGCCCCTGCTCTTGAGTGCTGTCTGGCTGACA
ACAGCTGGTGTCATCTACAATCCTCTGGGCGCCTGGCTCCATGATAAAATTAACTCCCGGCGCGGCATGTACATG
ACTGGCTTTGTCGGCATTATCGTATCTACATCCTGTCTGGCTGCTATGACCGCCCAGTATGCTGGTACAACAAAC
AAGGTCGGAAATGGATTTGGTATATTCTTCATGTACCTTTATCTGGCCTTCCAGGGTACTTTCTGTGATACCACC
ATGTATCTCTATGTCTCCGAGATCTTCCCGACTGAAATCCGACCAATTGGCATGGGCTTTTCTCTCTTCGGTCAA
TTTGCTGCCACCCTCATCCTCCTGCAAACTGCCCCCATGGGCTTCGGGAATGTCGGCTGGAAATATTATCTTGTC
ATTATTTGCTGGTCTGCATTCTTCATTCCCGTCATCTACTTCTTCTTCCCCGAGACTGCTGGTCTCACCCTAGAG
GAAATCGCCAAAAATTTCGGCGAGGAGGTTGCTTTTGACCTCACCGGCGCCACAGATGAGGAAAAAGCTCGGCTC
GACCACCAGCTAGCCACAGATGACGTTCAATCATCTGTGGGCTCGGAGCTAGAGAAGGAAACTAAGCCGTTGTCA
ACAGATGGGGCTGAGCAGCATGTGCCGAAAGCAGAATAA
Gene >Pro_DTO377G3_2|g2671.t1
ATGGGTAGGTTCGGGTCTCAGACCAGTTCCTATAACAGGCTGGTTATTGTTTTTGTGGCTGTTGGGTCAATGGTG
AGCTCGCAGATATGTTCAAGTCTCTGCTATTCACTAAACTGACACAAATAGACATATGGATATTGCTCTTCGATT
ATCTCCAGTACAATCGGCCAGCCGGGATGGTATGCCTACTTTAGCCTGCCCGCCGAGGGTGAACCGGGATACGCG
ACAATCACTACCCCCGCGATCTCGACAGCAAATGGTGTTTTCAGTGCTGGTGGTGCTGTTGGTACACTTTTTATA
ATGTGGTCGTGTGATTTCTTTGGCCGAAAGGCAAACATCCAGTTCGGTGCCTTCTTTTCTCTATTTGGAGGAGCA
CTTCAAGCCGGCTCGAATTCACTAGCGTATGTCGCTTCTCCTGCTCGAGGGTTAGACTGGCGCTGACAAGATTTA
GTATGTTCCAAGCTGGTCGCTTCATTTGTGGTCTTGGAATCGGTATCCTCGTAACCGTCTGCCCTATGTATCTTT
CCGAGATGTCGAGTGCTCTGCGCCGTGGCTGGCTTGTCGGCCACCACGCCATTTTCTTGGTCTTCGGATACATGC
TTTCGGGATGGGTGGGGTATGCCTGCTACTATGCAACAGGCCCCCTGTCTGGGTTTGGCTGGAGATTCCCTCTCG
CCTTGCAATGTCTGCCCGCGTTGGTGCTGCTTCTGGGATCTCCTTGGCTCCCCCGTTCACCTCGTTGGTTGATTT
CGAAGGGTAAGCTCGATGAGGCGCAGCATGTTCTCGAACGGCTCCGTGAATCACCAGATGACCCGAATAACTTGG
CTGCCAAGGAAGAGTTCTTCCAGACAAAAGAGCAAATCCGACTCGAGGCTGAGAGATTAGCTACTTACGGCAGCG
TGTGGAAAGCTGTCTTTACAAGGAAAACATACCGAAAGCGAATGGCTATCGGTTTCCTTGCCCAATGGGGCGCTG
AATTTGGCGGGCCTCTGATCATCGTAAGTGTGGTAATATCCGACAGAGAAGTATATCCGACTGACAACGGCCAGA
ACAATTACGCTGTTCTTCTATACAAAAACTTGGGCATGGAGGGTGGCATGCCCCTGCTCTTGAGTGCTGTCTGGC
TGACAACAGCTGGTGAGCATAAACATCCAGGGTCTACTGTGTACACCGTTAGCTAACCTAGTTCAGGTGTCATCT
ACAATCCTCTGGGCGCCTGGCTCCATGATAAAATTAACTCCCGGCGCGGCATGTACATGACTGGCTTTGTCGGCA
TTATCGTATCTACATCCTGTCTGGCTGCTATGACCGCCCAGTATGCTGGTACAACAAACAAGGTCGGAAATGGAT
TTGGTATATTCTTCATGTACCTTTATCTGGCCTTCCAGGGGTGAGTCAAACTTCAACATATCAAGTCCGCTGAAT
ATATCGAGCTGACATTCCTGCAGTACTTTCTGTGATACCACCATGTATCTCTATGTCTCCGAGATCTTCCCGACT
GAAATCCGACCAATTGGCATGGGCTTTTCTCTCTTCGGTCAATTTGCTGGTAAGTATTTCGTTACAATTTCGCCT
CCAAATTCTAACTGACATACTTAGCCACCCTCATCCTCCTGCAAACTGCCCCCATGGGCTTCGGGAATGTCGGCT
GGAAATATTATCTTGTCATTATTTGCTGGTCTGCATTCTTCATTCCCGGTATGTGTTCCCAATAATATCAAATCG
ACCCGTCAACTAAAATTTCGCTAACAAAAACTGCAGTCATCTACTTCTTCTTCCCCGAGACTGCTGGTCTCACCC
TAGAGGAAATCGCCAAAAATTTCGGCGAGGAGGTTGCTTTTGACCTCACCGGCGCCACAGATGAGGAAAAAGCTC
GGCTCGACCACCAGCTAGCCACAGATGACGTTCAATCATCTGTGGGCTCGGAGCTAGAGAAGGAAACTAAGCCGT
TGTCAACAGATGGGGCTGAGCAGCATGTGCCGAAAGCAGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail