Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2668.t1
Gene name
Locationscaffold_03:636987..639465
Strand-
Gene length (bp)2478
Transcript length (bp)2478
Coding sequence length (bp)2478
Protein length (aa) 826

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.0E-06 178 238
PF12796 Ank_2 Ankyrin repeats (3 copies) 4.5E-11 245 331
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.2E-07 386 481
PF12796 Ank_2 Ankyrin repeats (3 copies) 7.9E-10 424 514
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.8E-07 457 545
PF13637 Ank_4 Ankyrin repeats (many copies) 4.7E-05 243 287
PF13606 Ank_3 Ankyrin repeat 3.4E-03 269 294
PF00023 Ank Ankyrin repeat 2.0E-02 270 294
PF12937 F-box-like F-box-like 1.3E-05 7 49

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2668.t1
MPPSVSFSHLPVEVIYLIVDLLEPARYLNSLAQTCSRLYLLLTPMLYQNSTRSSHGFPIVWAAQHSSEGTIRQAF
DAGASTYSCHYNFQQSLVAAVNNNHETIVRLILEQNEDPSIFTEKQSCKLCKGQKSEEAASKVLNPLYAAAVRGN
VAIVRLLLAYKITFEHGCGERTPICSDIVFAAVNSGHLAVMQVLIEAGYAWDDKRRRYQDKTPLTVAVDQGDARM
VEYLLDKGAKPSRDDKPLLESAAENGHLETVKLLLERGAEPQGSALSCAAGNGHVEVVEVLLDHGADPDPDMVRD
CLSTLYYVAVSGQLQILDLLLARGVNIYPKDPKKKRYLLSSIIEDELWRSVERQKRSAFAVSFRALADFENMIDH
GDDLAQAEILYIAIGYGWDDIVQRVLEQSFSADGIYQHCKLRYNRPILQAIQNGDIGITRLLVEHGANIQEYQGE
SKDEGALSLAIQLGNVKIAELLIDHGADVNCISSRGETALAEATALASEDIFRMLLDRGADPTKTPLYTDENAVT
RALYFGAVDAVQTLLERGIALEMPPLPEEQEKLTNHRGLYTPKNPKTLLEEAFLGGEQMAELVLDRGLLNIDPES
YGAQEGLEHAVQLGMTGVVKQLLERGVDPKIPLLSGRQSLIVTAPYSPATDSRINATAILDMLLAHGADIDERRL
PSITPLYRVILDVNSGNQQVRLLLERGADPFAVHACYRALVTEASDDNFNSILRVKRSMPSPDTWRPKKTFIFVP
NMSELKDDPFLACMRRGDKAMLEAMLDAIDRKGLPLEELKDRLDRARMEATESGNLHLLPILQDYYWVKNIHARS
*
Coding >Pro_DTO377G3_2|g2668.t1
ATGCCTCCCTCCGTGTCTTTCTCTCATCTTCCAGTCGAAGTCATCTACTTAATTGTTGATCTCCTCGAGCCAGCA
CGTTACCTCAACTCGTTGGCGCAGACATGTTCGCGGCTATATCTGCTCTTGACCCCAATGCTCTATCAAAACAGC
ACTCGTTCATCACACGGGTTCCCCATTGTATGGGCAGCACAGCATAGCTCCGAAGGGACCATTCGCCAAGCATTT
GACGCTGGAGCTTCCACATATTCATGTCATTACAACTTTCAACAATCGCTCGTCGCGGCAGTGAACAACAACCAT
GAGACCATCGTCCGACTGATACTGGAACAAAATGAAGACCCTAGTATATTCACAGAAAAGCAGAGCTGCAAGCTG
TGCAAAGGCCAGAAATCCGAGGAGGCCGCCTCAAAAGTTCTCAATCCACTATATGCGGCGGCAGTGCGTGGCAAC
GTGGCCATTGTCAGGCTTTTGCTTGCCTATAAGATCACTTTCGAACATGGTTGCGGAGAACGTACTCCGATATGC
TCCGATATCGTATTTGCGGCAGTAAACAGCGGACACCTAGCCGTTATGCAAGTTCTCATCGAGGCTGGCTACGCC
TGGGACGACAAAAGAAGAAGATACCAGGATAAGACACCACTCACTGTTGCAGTCGATCAGGGTGATGCAAGAATG
GTTGAATACTTGCTGGACAAAGGGGCCAAACCCTCGCGTGATGATAAGCCACTTCTTGAGTCTGCCGCGGAAAAT
GGACACCTTGAAACGGTCAAATTGCTCCTGGAACGCGGAGCAGAGCCTCAAGGAAGCGCTCTTTCCTGCGCGGCT
GGCAATGGCCATGTGGAGGTCGTGGAAGTGCTCTTAGACCATGGGGCGGATCCCGATCCTGATATGGTTCGAGAT
TGTCTGAGTACACTCTACTATGTAGCTGTAAGTGGTCAGCTACAAATCCTTGATCTTCTGTTGGCACGTGGGGTG
AACATATACCCCAAGGACCCAAAGAAAAAACGCTACTTGTTATCATCCATAATCGAAGATGAACTCTGGCGATCA
GTTGAGAGGCAGAAGCGGTCTGCTTTCGCTGTTTCCTTTCGAGCCCTCGCCGATTTTGAGAACATGATAGACCAC
GGAGATGACCTAGCACAAGCTGAGATTCTGTACATAGCTATTGGCTATGGGTGGGATGATATTGTGCAGCGTGTT
CTGGAGCAGAGCTTTTCCGCAGATGGAATATATCAGCACTGTAAGCTCCGGTATAACAGGCCTATACTCCAAGCC
ATTCAGAACGGTGATATTGGAATTACCAGACTCTTGGTTGAGCATGGTGCCAATATACAGGAGTACCAGGGAGAA
AGCAAGGATGAAGGCGCGCTATCCTTGGCAATCCAATTGGGCAATGTAAAAATTGCAGAGCTTTTGATCGACCAC
GGGGCTGATGTAAATTGCATAAGCAGCCGCGGAGAAACTGCTTTGGCAGAGGCGACGGCATTGGCGTCCGAAGAC
ATATTTCGCATGTTGCTTGATCGAGGAGCTGATCCGACGAAAACGCCATTATATACCGATGAAAACGCCGTCACC
AGAGCATTGTACTTCGGTGCAGTGGATGCGGTACAGACCTTGCTTGAGAGAGGCATTGCATTGGAAATGCCTCCG
TTGCCCGAGGAGCAAGAAAAGCTCACGAACCACCGAGGACTCTATACTCCAAAGAATCCCAAGACATTGCTAGAA
GAGGCATTCTTGGGAGGAGAACAAATGGCGGAGCTGGTCTTAGACCGGGGATTGTTGAATATAGACCCTGAGAGC
TATGGGGCGCAAGAAGGATTAGAGCACGCTGTCCAACTTGGAATGACTGGGGTGGTGAAGCAGCTACTTGAACGA
GGAGTTGATCCTAAAATACCTTTACTATCCGGTCGCCAATCTTTGATAGTGACTGCACCATATTCTCCAGCCACT
GACAGTAGAATTAATGCTACAGCCATTCTTGATATGCTCTTAGCCCATGGTGCTGATATCGATGAACGGCGGCTT
CCTAGCATTACACCCTTATATCGGGTCATCTTGGATGTCAACTCCGGAAATCAGCAGGTGCGACTCTTGCTGGAG
AGAGGCGCAGATCCCTTCGCGGTGCATGCTTGCTATCGCGCACTCGTTACAGAGGCAAGCGATGACAATTTCAAC
TCAATACTCAGGGTCAAACGGTCAATGCCTAGTCCCGATACCTGGCGTCCCAAAAAAACGTTTATATTTGTGCCG
AATATGAGCGAACTGAAAGATGACCCATTCCTTGCATGCATGAGACGGGGCGATAAAGCGATGCTTGAGGCCATG
CTTGACGCGATTGATCGGAAAGGACTTCCCTTGGAGGAGTTGAAGGATAGACTTGATCGAGCTCGGATGGAAGCG
ACTGAGAGTGGGAACCTGCACCTTCTACCCATTCTGCAGGATTATTACTGGGTAAAAAATATCCACGCAAGAAGC
TGA
Transcript >Pro_DTO377G3_2|g2668.t1
ATGCCTCCCTCCGTGTCTTTCTCTCATCTTCCAGTCGAAGTCATCTACTTAATTGTTGATCTCCTCGAGCCAGCA
CGTTACCTCAACTCGTTGGCGCAGACATGTTCGCGGCTATATCTGCTCTTGACCCCAATGCTCTATCAAAACAGC
ACTCGTTCATCACACGGGTTCCCCATTGTATGGGCAGCACAGCATAGCTCCGAAGGGACCATTCGCCAAGCATTT
GACGCTGGAGCTTCCACATATTCATGTCATTACAACTTTCAACAATCGCTCGTCGCGGCAGTGAACAACAACCAT
GAGACCATCGTCCGACTGATACTGGAACAAAATGAAGACCCTAGTATATTCACAGAAAAGCAGAGCTGCAAGCTG
TGCAAAGGCCAGAAATCCGAGGAGGCCGCCTCAAAAGTTCTCAATCCACTATATGCGGCGGCAGTGCGTGGCAAC
GTGGCCATTGTCAGGCTTTTGCTTGCCTATAAGATCACTTTCGAACATGGTTGCGGAGAACGTACTCCGATATGC
TCCGATATCGTATTTGCGGCAGTAAACAGCGGACACCTAGCCGTTATGCAAGTTCTCATCGAGGCTGGCTACGCC
TGGGACGACAAAAGAAGAAGATACCAGGATAAGACACCACTCACTGTTGCAGTCGATCAGGGTGATGCAAGAATG
GTTGAATACTTGCTGGACAAAGGGGCCAAACCCTCGCGTGATGATAAGCCACTTCTTGAGTCTGCCGCGGAAAAT
GGACACCTTGAAACGGTCAAATTGCTCCTGGAACGCGGAGCAGAGCCTCAAGGAAGCGCTCTTTCCTGCGCGGCT
GGCAATGGCCATGTGGAGGTCGTGGAAGTGCTCTTAGACCATGGGGCGGATCCCGATCCTGATATGGTTCGAGAT
TGTCTGAGTACACTCTACTATGTAGCTGTAAGTGGTCAGCTACAAATCCTTGATCTTCTGTTGGCACGTGGGGTG
AACATATACCCCAAGGACCCAAAGAAAAAACGCTACTTGTTATCATCCATAATCGAAGATGAACTCTGGCGATCA
GTTGAGAGGCAGAAGCGGTCTGCTTTCGCTGTTTCCTTTCGAGCCCTCGCCGATTTTGAGAACATGATAGACCAC
GGAGATGACCTAGCACAAGCTGAGATTCTGTACATAGCTATTGGCTATGGGTGGGATGATATTGTGCAGCGTGTT
CTGGAGCAGAGCTTTTCCGCAGATGGAATATATCAGCACTGTAAGCTCCGGTATAACAGGCCTATACTCCAAGCC
ATTCAGAACGGTGATATTGGAATTACCAGACTCTTGGTTGAGCATGGTGCCAATATACAGGAGTACCAGGGAGAA
AGCAAGGATGAAGGCGCGCTATCCTTGGCAATCCAATTGGGCAATGTAAAAATTGCAGAGCTTTTGATCGACCAC
GGGGCTGATGTAAATTGCATAAGCAGCCGCGGAGAAACTGCTTTGGCAGAGGCGACGGCATTGGCGTCCGAAGAC
ATATTTCGCATGTTGCTTGATCGAGGAGCTGATCCGACGAAAACGCCATTATATACCGATGAAAACGCCGTCACC
AGAGCATTGTACTTCGGTGCAGTGGATGCGGTACAGACCTTGCTTGAGAGAGGCATTGCATTGGAAATGCCTCCG
TTGCCCGAGGAGCAAGAAAAGCTCACGAACCACCGAGGACTCTATACTCCAAAGAATCCCAAGACATTGCTAGAA
GAGGCATTCTTGGGAGGAGAACAAATGGCGGAGCTGGTCTTAGACCGGGGATTGTTGAATATAGACCCTGAGAGC
TATGGGGCGCAAGAAGGATTAGAGCACGCTGTCCAACTTGGAATGACTGGGGTGGTGAAGCAGCTACTTGAACGA
GGAGTTGATCCTAAAATACCTTTACTATCCGGTCGCCAATCTTTGATAGTGACTGCACCATATTCTCCAGCCACT
GACAGTAGAATTAATGCTACAGCCATTCTTGATATGCTCTTAGCCCATGGTGCTGATATCGATGAACGGCGGCTT
CCTAGCATTACACCCTTATATCGGGTCATCTTGGATGTCAACTCCGGAAATCAGCAGGTGCGACTCTTGCTGGAG
AGAGGCGCAGATCCCTTCGCGGTGCATGCTTGCTATCGCGCACTCGTTACAGAGGCAAGCGATGACAATTTCAAC
TCAATACTCAGGGTCAAACGGTCAATGCCTAGTCCCGATACCTGGCGTCCCAAAAAAACGTTTATATTTGTGCCG
AATATGAGCGAACTGAAAGATGACCCATTCCTTGCATGCATGAGACGGGGCGATAAAGCGATGCTTGAGGCCATG
CTTGACGCGATTGATCGGAAAGGACTTCCCTTGGAGGAGTTGAAGGATAGACTTGATCGAGCTCGGATGGAAGCG
ACTGAGAGTGGGAACCTGCACCTTCTACCCATTCTGCAGGATTATTACTGGGTAAAAAATATCCACGCAAGAAGC
TGA
Gene >Pro_DTO377G3_2|g2668.t1
ATGCCTCCCTCCGTGTCTTTCTCTCATCTTCCAGTCGAAGTCATCTACTTAATTGTTGATCTCCTCGAGCCAGCA
CGTTACCTCAACTCGTTGGCGCAGACATGTTCGCGGCTATATCTGCTCTTGACCCCAATGCTCTATCAAAACAGC
ACTCGTTCATCACACGGGTTCCCCATTGTATGGGCAGCACAGCATAGCTCCGAAGGGACCATTCGCCAAGCATTT
GACGCTGGAGCTTCCACATATTCATGTCATTACAACTTTCAACAATCGCTCGTCGCGGCAGTGAACAACAACCAT
GAGACCATCGTCCGACTGATACTGGAACAAAATGAAGACCCTAGTATATTCACAGAAAAGCAGAGCTGCAAGCTG
TGCAAAGGCCAGAAATCCGAGGAGGCCGCCTCAAAAGTTCTCAATCCACTATATGCGGCGGCAGTGCGTGGCAAC
GTGGCCATTGTCAGGCTTTTGCTTGCCTATAAGATCACTTTCGAACATGGTTGCGGAGAACGTACTCCGATATGC
TCCGATATCGTATTTGCGGCAGTAAACAGCGGACACCTAGCCGTTATGCAAGTTCTCATCGAGGCTGGCTACGCC
TGGGACGACAAAAGAAGAAGATACCAGGATAAGACACCACTCACTGTTGCAGTCGATCAGGGTGATGCAAGAATG
GTTGAATACTTGCTGGACAAAGGGGCCAAACCCTCGCGTGATGATAAGCCACTTCTTGAGTCTGCCGCGGAAAAT
GGACACCTTGAAACGGTCAAATTGCTCCTGGAACGCGGAGCAGAGCCTCAAGGAAGCGCTCTTTCCTGCGCGGCT
GGCAATGGCCATGTGGAGGTCGTGGAAGTGCTCTTAGACCATGGGGCGGATCCCGATCCTGATATGGTTCGAGAT
TGTCTGAGTACACTCTACTATGTAGCTGTAAGTGGTCAGCTACAAATCCTTGATCTTCTGTTGGCACGTGGGGTG
AACATATACCCCAAGGACCCAAAGAAAAAACGCTACTTGTTATCATCCATAATCGAAGATGAACTCTGGCGATCA
GTTGAGAGGCAGAAGCGGTCTGCTTTCGCTGTTTCCTTTCGAGCCCTCGCCGATTTTGAGAACATGATAGACCAC
GGAGATGACCTAGCACAAGCTGAGATTCTGTACATAGCTATTGGCTATGGGTGGGATGATATTGTGCAGCGTGTT
CTGGAGCAGAGCTTTTCCGCAGATGGAATATATCAGCACTGTAAGCTCCGGTATAACAGGCCTATACTCCAAGCC
ATTCAGAACGGTGATATTGGAATTACCAGACTCTTGGTTGAGCATGGTGCCAATATACAGGAGTACCAGGGAGAA
AGCAAGGATGAAGGCGCGCTATCCTTGGCAATCCAATTGGGCAATGTAAAAATTGCAGAGCTTTTGATCGACCAC
GGGGCTGATGTAAATTGCATAAGCAGCCGCGGAGAAACTGCTTTGGCAGAGGCGACGGCATTGGCGTCCGAAGAC
ATATTTCGCATGTTGCTTGATCGAGGAGCTGATCCGACGAAAACGCCATTATATACCGATGAAAACGCCGTCACC
AGAGCATTGTACTTCGGTGCAGTGGATGCGGTACAGACCTTGCTTGAGAGAGGCATTGCATTGGAAATGCCTCCG
TTGCCCGAGGAGCAAGAAAAGCTCACGAACCACCGAGGACTCTATACTCCAAAGAATCCCAAGACATTGCTAGAA
GAGGCATTCTTGGGAGGAGAACAAATGGCGGAGCTGGTCTTAGACCGGGGATTGTTGAATATAGACCCTGAGAGC
TATGGGGCGCAAGAAGGATTAGAGCACGCTGTCCAACTTGGAATGACTGGGGTGGTGAAGCAGCTACTTGAACGA
GGAGTTGATCCTAAAATACCTTTACTATCCGGTCGCCAATCTTTGATAGTGACTGCACCATATTCTCCAGCCACT
GACAGTAGAATTAATGCTACAGCCATTCTTGATATGCTCTTAGCCCATGGTGCTGATATCGATGAACGGCGGCTT
CCTAGCATTACACCCTTATATCGGGTCATCTTGGATGTCAACTCCGGAAATCAGCAGGTGCGACTCTTGCTGGAG
AGAGGCGCAGATCCCTTCGCGGTGCATGCTTGCTATCGCGCACTCGTTACAGAGGCAAGCGATGACAATTTCAAC
TCAATACTCAGGGTCAAACGGTCAATGCCTAGTCCCGATACCTGGCGTCCCAAAAAAACGTTTATATTTGTGCCG
AATATGAGCGAACTGAAAGATGACCCATTCCTTGCATGCATGAGACGGGGCGATAAAGCGATGCTTGAGGCCATG
CTTGACGCGATTGATCGGAAAGGACTTCCCTTGGAGGAGTTGAAGGATAGACTTGATCGAGCTCGGATGGAAGCG
ACTGAGAGTGGGAACCTGCACCTTCTACCCATTCTGCAGGATTATTACTGGGTAAAAAATATCCACGCAAGAAGC
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail