Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2664.t1
Gene name
Locationscaffold_03:630164..631489
Strand-
Gene length (bp)1325
Transcript length (bp)1215
Coding sequence length (bp)1215
Protein length (aa) 405

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13344 Hydrolase_6 Haloacid dehalogenase-like hydrolase 3.0E-24 42 150
PF13242 Hydrolase_like HAD-hyrolase-like 5.0E-16 301 389

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 25.93 13.23 38.63
5d_25C Five days - 25 degrees Celsius 20.51 9.80 31.22
7d_25C Seven days - 25 degrees Celsius 12.76 5.33 20.20
10d_25C Ten days - 25 degrees Celsius 11.07 4.31 17.82
7d_15C Seven days - 15 degrees Celsius 33.68 18.15 49.21
7d_30C Seven days - 30 degrees Celsius 15.48 6.89 24.07

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.467274 no
3d_25C 7d_25C 0.010411 yes
3d_25C 7d_15C 0.367186 no
3d_25C 7d_30C 0.069866 no
3d_25C 10d_25C 0.001278 yes
5d_25C 7d_25C 0.129599 no
5d_25C 7d_15C 0.065131 no
5d_25C 7d_30C 0.403690 no
5d_25C 10d_25C 0.039155 yes
7d_25C 7d_15C 0.000700 yes
7d_25C 7d_30C 0.626926 no
7d_25C 10d_25C 0.747693 no
7d_15C 7d_30C 0.004450 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.350042 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2664.t1
MRSQTLWRSFGLLQRQSLSTHKTVTRRAIQTASSRPIPNFAFAFDIDGVLLRASKPLPGAADSLALLKKQGIPFL
LLTNGGGKHETERVAEISEKLGIPLDATDIVQSHSPFAELVKGPDESSALEHKCVLVAGGDGDNCRRVAERYGFK
NVVTPADILMANPAVCPFSMNFSEYYKTFARPLPHPVDFNDASKTLKIDAVFVFNDPRDWALDTQVIMDLLLSSQ
GRLGTLSEKNGRIDLPNHGYQQDGQPHLYFSNPDLWWAAAYPLPRLGQGGFREALEGVWAAATGGPSKGIELKKT
VIGKPYQPTYQFAERQLLRNRLRTFGSSAESTPLERVYMVGDNPESDIRGANSYRSEIGSSWHSILVRTGVYRGG
EPAWIPETIADNVQKGVQWALKNSNWPAA*
Coding >Pro_DTO377G3_2|g2664.t1
ATGAGATCGCAAACCCTTTGGCGGTCATTTGGCCTATTGCAGCGTCAATCCCTCTCTACTCATAAAACTGTCACC
CGCCGAGCTATCCAAACAGCTAGTTCTCGACCGATCCCCAACTTCGCATTTGCATTTGACATTGATGGCGTCCTC
CTCCGCGCATCGAAACCTTTGCCCGGTGCCGCCGACTCGCTTGCTCTCCTGAAGAAACAAGGAATCCCCTTTCTT
CTGCTCACCAACGGCGGCGGTAAACACGAGACGGAGCGTGTCGCGGAAATCAGCGAGAAACTAGGAATACCACTG
GATGCTACGGACATTGTGCAGAGTCACTCACCCTTTGCTGAGCTGGTCAAGGGACCGGACGAGTCGAGCGCCCTG
GAACACAAGTGTGTGTTAGTGGCCGGAGGCGATGGGGATAACTGCCGGCGCGTGGCAGAACGGTACGGCTTCAAG
AATGTTGTAACTCCGGCGGATATTCTTATGGCAAACCCCGCTGTCTGTCCGTTTTCGATGAACTTCAGCGAATAT
TATAAAACATTTGCCCGACCGCTCCCGCACCCCGTTGATTTCAATGATGCGTCGAAGACTTTGAAGATCGATGCT
GTCTTTGTGTTCAATGATCCTCGTGATTGGGCGTTGGACACCCAGGTTATTATGGACCTCCTCCTCTCATCGCAA
GGCCGTCTAGGCACTTTGTCTGAAAAGAACGGACGAATCGATCTTCCCAATCATGGGTACCAACAGGATGGCCAG
CCCCATCTATACTTTTCTAATCCAGATTTGTGGTGGGCCGCCGCCTACCCCTTGCCCCGTCTTGGTCAGGGCGGA
TTCCGGGAAGCGCTTGAGGGCGTCTGGGCTGCGGCTACAGGTGGCCCCAGCAAGGGTATTGAGTTGAAGAAGACC
GTGATCGGCAAACCTTACCAACCCACCTACCAGTTCGCAGAGCGTCAATTGCTTCGGAACCGGCTGAGAACATTT
GGAAGCTCTGCTGAAAGCACGCCCCTGGAAAGAGTATATATGGTCGGTGATAATCCAGAGTCAGATATCCGAGGA
GCCAACTCCTATCGCAGTGAAATTGGCAGTAGCTGGCACTCGATCCTTGTCCGCACTGGGGTATACCGTGGCGGA
GAGCCTGCTTGGATCCCTGAGACAATTGCTGACAATGTACAAAAAGGTGTTCAATGGGCACTGAAGAACTCGAAC
TGGCCTGCTGCGTGA
Transcript >Pro_DTO377G3_2|g2664.t1
ATGAGATCGCAAACCCTTTGGCGGTCATTTGGCCTATTGCAGCGTCAATCCCTCTCTACTCATAAAACTGTCACC
CGCCGAGCTATCCAAACAGCTAGTTCTCGACCGATCCCCAACTTCGCATTTGCATTTGACATTGATGGCGTCCTC
CTCCGCGCATCGAAACCTTTGCCCGGTGCCGCCGACTCGCTTGCTCTCCTGAAGAAACAAGGAATCCCCTTTCTT
CTGCTCACCAACGGCGGCGGTAAACACGAGACGGAGCGTGTCGCGGAAATCAGCGAGAAACTAGGAATACCACTG
GATGCTACGGACATTGTGCAGAGTCACTCACCCTTTGCTGAGCTGGTCAAGGGACCGGACGAGTCGAGCGCCCTG
GAACACAAGTGTGTGTTAGTGGCCGGAGGCGATGGGGATAACTGCCGGCGCGTGGCAGAACGGTACGGCTTCAAG
AATGTTGTAACTCCGGCGGATATTCTTATGGCAAACCCCGCTGTCTGTCCGTTTTCGATGAACTTCAGCGAATAT
TATAAAACATTTGCCCGACCGCTCCCGCACCCCGTTGATTTCAATGATGCGTCGAAGACTTTGAAGATCGATGCT
GTCTTTGTGTTCAATGATCCTCGTGATTGGGCGTTGGACACCCAGGTTATTATGGACCTCCTCCTCTCATCGCAA
GGCCGTCTAGGCACTTTGTCTGAAAAGAACGGACGAATCGATCTTCCCAATCATGGGTACCAACAGGATGGCCAG
CCCCATCTATACTTTTCTAATCCAGATTTGTGGTGGGCCGCCGCCTACCCCTTGCCCCGTCTTGGTCAGGGCGGA
TTCCGGGAAGCGCTTGAGGGCGTCTGGGCTGCGGCTACAGGTGGCCCCAGCAAGGGTATTGAGTTGAAGAAGACC
GTGATCGGCAAACCTTACCAACCCACCTACCAGTTCGCAGAGCGTCAATTGCTTCGGAACCGGCTGAGAACATTT
GGAAGCTCTGCTGAAAGCACGCCCCTGGAAAGAGTATATATGGTCGGTGATAATCCAGAGTCAGATATCCGAGGA
GCCAACTCCTATCGCAGTGAAATTGGCAGTAGCTGGCACTCGATCCTTGTCCGCACTGGGGTATACCGTGGCGGA
GAGCCTGCTTGGATCCCTGAGACAATTGCTGACAATGTACAAAAAGGTGTTCAATGGGCACTGAAGAACTCGAAC
TGGCCTGCTGCGTGA
Gene >Pro_DTO377G3_2|g2664.t1
ATGAGATCGCAAACCCTTTGGCGGTCATTTGGCCTATTGCAGCGTCAATCCCTCTCTACTCATAAAACTGTCACC
CGCCGAGCTATCCAAACAGCTAGTTCTCGACCGATCCCCAACTTCGCATTTGCATTTGAGTGAGTCTTGACCGGC
GAACACAATTCACTCGATTTTCTTCTCACATGCTACAGCATTGATGGCGTCCTCCTCCGCGCATCGAAACCTTTG
CCCGGTGCCGCCGACTCGCTTGCTCTCCTGAAGAAACAAGGAATCCCCTTTCTTCTGCTCACCAACGGCGGCGGT
AAACACGAGACGGAGCGTGTCGCGGAAATCAGCGAGAAACTAGGAATACCACTGGATGCTACGGACATTGTGCAG
AGTCACTCACCCTTTGCTGAGCTGGTCAAGGGACCGGACGAGTCGAGCGCCCTGGAACACAAGTGTGTGTTAGTG
GCCGGAGGCGATGGGGATAACTGCCGGCGCGTGGCAGAACGGTATATCAAGGACCCCTTCCTATTGCTGAATGAT
ATATGCTAATTAATAGTAATAGGTACGGCTTCAAGAATGTTGTAACTCCGGCGGATATTCTTATGGCAAACCCCG
CTGTCTGTCCGTTTTCGATGAACTTCAGCGAATATTATAAAACATTTGCCCGACCGCTCCCGCACCCCGTTGATT
TCAATGATGCGTCGAAGACTTTGAAGATCGATGCTGTCTTTGTGTTCAATGATCCTCGTGATTGGGCGTTGGACA
CCCAGGTTATTATGGACCTCCTCCTCTCATCGCAAGGCCGTCTAGGCACTTTGTCTGAAAAGAACGGACGAATCG
ATCTTCCCAATCATGGGTACCAACAGGATGGCCAGCCCCATCTATACTTTTCTAATCCAGATTTGTGGTGGGCCG
CCGCCTACCCCTTGCCCCGTCTTGGTCAGGGCGGATTCCGGGAAGCGCTTGAGGGCGTCTGGGCTGCGGCTACAG
GTGGCCCCAGCAAGGGTATTGAGTTGAAGAAGACCGTGATCGGCAAACCTTACCAACCCACCTACCAGTTCGCAG
AGCGTCAATTGCTTCGGAACCGGCTGAGAACATTTGGAAGCTCTGCTGAAAGCACGCCCCTGGAAAGAGTATATA
TGGTCGGTGATAATCCAGAGTCAGATATCCGAGGAGCCAACTCCTATCGCAGTGAAATTGGCAGTAGCTGGCACT
CGATCCTTGTCCGCACTGGGGTATACCGTGGCGGAGAGCCTGCTTGGATCCCTGAGACAATTGCTGACAATGTAC
AAAAAGGTGTTCAATGGGCACTGAAGAACTCGAACTGGCCTGCTGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail