Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2662.t1
Gene name
Locationscaffold_03:624620..627611
Strand+
Gene length (bp)2991
Transcript length (bp)2751
Coding sequence length (bp)2751
Protein length (aa) 917

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01602 Adaptin_N Adaptin N terminal region 4.8E-112 22 556
PF08752 COP-gamma_platf Coatomer gamma subunit appendage platform subdomain 1.1E-56 650 799
PF16381 Coatomer_g_Cpla Coatomer subunit gamma-1 C-terminal appendage platform 1.8E-34 801 915
PF13646 HEAT_2 HEAT repeats 1.5E-11 452 551

GO

GO Term Description Terminal node
GO:0030117 membrane coat Yes
GO:0016192 vesicle-mediated transport Yes
GO:0005198 structural molecule activity Yes
GO:0030126 COPI vesicle coat Yes
GO:0006886 intracellular protein transport Yes
GO:0071702 organic substance transport No
GO:0030120 vesicle coat No
GO:0046907 intracellular transport No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0015031 protein transport No
GO:0005575 cellular_component No
GO:0051234 establishment of localization No
GO:0051641 cellular localization No
GO:0032991 protein-containing complex No
GO:0045184 establishment of protein localization No
GO:0003674 molecular_function No
GO:0070727 cellular macromolecule localization No
GO:0051649 establishment of localization in cell No
GO:0051179 localization No
GO:0008104 protein localization No
GO:0071705 nitrogen compound transport No
GO:0033036 macromolecule localization No
GO:0098796 membrane protein complex No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2662.t1
MSYMKKNEDEDQVMIKLDRTSVFQDARLFNSSPISPRTCRTLLTKIAVLMFTGEQFPTNEATTLFFGISKLFQNK
DPSLRQMVYLILKELAGTAEDVIMSTSIIMKDTAVGSDVLYRANAIRALCRIIDGSTVQGIERLIKTAIVDKTPS
VSSAALVSSYHLLPIARDVVRRWQSETQEAASSSKSSTGFLGFSGSQSHAISNSNFMTQYHAIGLLYQMRSHDRM
SLVKMVQQYGAAGVVKSPAALVLLVRLAAKLAEEDQGLRKPMMQMLDGWLRHKHEMVNFEAAKAICDMRDVTDAE
ATQAVHVLQLFLSSPRSITKFAAIRILHNFASFKPHVVNVCNPDIESLISNSNRSIATFAITTLLKTGNEASVDR
LMKQISGFMADITDEFKVTIVEAIRTLCLKFPSKQAGMLVFLSGILRDEGGYEFKRTVVESMFDLIKFVPESKED
ALAHLCEFIEDCEFTKLSVRILHLLGSEGPKTTHPTKYIRYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKS
SVHVLLTRCLDDTDDEVRDRAALNLRLMSEDDESASAFIKNDSMYSLSTFEHQLVMYVTSGDKGTFATAFDVATI
PVVSHEQALAEERTKKLTSATPTLKAPSTGPPKGKAAGGMAEAASASATQKYAEQLLQYPDIKAYGILLKSSAPV
ELSESETEYVVTAVKHIFKEHIVVQYDIKNTLPDTILENVTVVATPEEEDVLEEDFIIPAPKLPTDQPGVVYVAF
KKLTGENSVPVTSFTNILKFTSKEIDPVSGEPEDSGYDDEYQVEDLELTGSDYVIPTFAGSFDHVWEQTGANGEE
ESETLQLSNMKGINDATEQLISALSLQPLEGTDVALNSSTHTLKLFGKTVSGGRVAALIKMAYSSKAGVTTKITV
RAEEEGVAAAVIASVS*
Coding >Pro_DTO377G3_2|g2662.t1
ATGAGTTACATGAAGAAAAACGAAGATGAGGACCAGGTCATGATCAAGCTTGATCGGACCTCCGTTTTCCAAGAT
GCACGCCTATTCAATTCCTCTCCTATCTCGCCGCGAACATGCCGAACGTTACTCACCAAGATCGCTGTCCTCATG
TTCACCGGGGAGCAGTTCCCTACGAATGAAGCCACCACTCTCTTCTTCGGAATCTCCAAGCTCTTCCAGAACAAA
GACCCGTCATTGCGGCAGATGGTGTACCTGATCTTGAAGGAGCTAGCTGGCACCGCCGAAGATGTGATCATGTCG
ACAAGTATCATTATGAAGGACACTGCGGTAGGAAGCGATGTCTTGTACCGGGCCAATGCCATCAGAGCGCTCTGC
CGCATTATCGATGGTTCCACAGTACAGGGTATCGAGCGACTTATCAAGACCGCCATTGTTGACAAGACCCCGTCG
GTGTCCTCCGCGGCCTTGGTCTCTTCCTACCATCTCCTCCCCATTGCGCGCGACGTTGTCCGGAGGTGGCAGAGC
GAAACACAGGAAGCGGCCTCGTCATCGAAATCATCGACCGGGTTCCTTGGTTTCTCAGGCTCACAGAGCCATGCT
ATCTCGAACTCGAATTTCATGACACAGTACCACGCCATCGGTCTTTTGTACCAGATGCGCTCGCACGATCGCATG
TCTTTGGTCAAAATGGTACAACAGTACGGCGCTGCAGGTGTGGTGAAGAGCCCGGCTGCTCTGGTTTTGTTGGTA
CGTCTGGCGGCCAAATTGGCCGAGGAGGACCAAGGTCTCCGGAAACCCATGATGCAGATGTTGGATGGCTGGCTC
CGCCACAAGCATGAGATGGTCAACTTTGAGGCGGCCAAGGCTATTTGCGATATGCGCGATGTCACCGATGCCGAG
GCAACGCAGGCAGTTCATGTTCTCCAGCTCTTCCTGTCCTCCCCCCGGTCAATCACCAAGTTCGCTGCAATCCGT
ATCCTACACAACTTCGCCTCTTTCAAGCCACACGTCGTCAATGTCTGCAACCCTGATATCGAGTCCCTTATCTCT
AACTCGAACCGTTCAATCGCAACGTTCGCCATTACGACACTGCTCAAGACTGGCAACGAAGCCAGCGTTGACCGT
TTGATGAAGCAAATCTCGGGCTTTATGGCTGATATCACCGACGAGTTCAAGGTCACTATTGTCGAAGCTATTCGC
ACTTTGTGTTTGAAGTTCCCCAGCAAGCAGGCCGGTATGCTCGTTTTCCTGAGTGGTATCCTGCGGGACGAGGGC
GGATACGAGTTCAAGCGCACTGTTGTTGAGAGCATGTTCGATTTGATCAAGTTTGTCCCGGAAAGCAAGGAAGAT
GCGCTTGCTCACCTCTGTGAGTTCATTGAGGATTGCGAGTTCACCAAGCTTTCGGTTAGAATCCTGCACCTGCTT
GGTTCCGAGGGCCCTAAGACTACCCATCCTACAAAGTATATCCGCTACATCTACAACCGCGTCGTATTGGAGAAC
GCCATCGTACGCGCCGCTGCTGTCACCGCATTGGCCAAATTTGGTGTTGGCCAGAAAGACCCCGAAGTCAAGTCT
AGTGTCCATGTTCTCCTCACCCGTTGTCTTGATGATACCGACGACGAGGTGCGAGACCGTGCTGCGCTTAACCTG
CGTCTGATGAGTGAAGACGATGAGTCGGCGAGCGCTTTCATTAAGAACGACTCAATGTATTCCCTTTCCACGTTT
GAACACCAGCTCGTCATGTATGTGACGTCTGGTGACAAGGGGACATTCGCTACTGCCTTCGATGTTGCCACCATT
CCGGTTGTCTCACACGAGCAGGCGCTGGCCGAGGAGAGGACCAAGAAGCTTACCTCAGCTACTCCCACTCTCAAG
GCGCCTTCGACCGGTCCCCCGAAGGGCAAGGCAGCCGGCGGTATGGCCGAAGCAGCCAGCGCCTCTGCCACCCAG
AAATACGCAGAGCAACTTCTGCAGTACCCCGATATCAAGGCTTACGGTATTTTGCTCAAGTCCTCCGCGCCTGTC
GAGCTTTCCGAGAGCGAAACCGAATACGTTGTTACGGCCGTCAAGCACATTTTCAAGGAACACATCGTGGTACAA
TATGATATCAAGAACACACTTCCGGATACTATTCTTGAGAATGTCACCGTGGTTGCCACGCCAGAAGAAGAGGAC
GTATTGGAGGAAGACTTTATCATTCCTGCCCCCAAGCTGCCCACAGACCAGCCTGGTGTTGTCTACGTTGCTTTC
AAGAAGCTCACCGGCGAGAACAGCGTCCCCGTCACCTCCTTCACAAACATCCTCAAGTTCACTAGCAAAGAAATC
GATCCCGTAAGCGGCGAGCCGGAGGACAGTGGCTACGACGACGAGTACCAGGTGGAGGACCTCGAGCTGACAGGC
AGTGACTATGTCATCCCGACATTCGCCGGCAGCTTCGACCACGTCTGGGAGCAGACTGGCGCCAATGGCGAGGAG
GAAAGCGAAACTCTGCAGCTCAGCAACATGAAGGGTATCAACGATGCCACGGAACAACTGATCTCAGCGCTATCT
CTGCAACCTCTAGAGGGTACCGACGTGGCCCTCAACAGCAGCACACACACTCTCAAGCTGTTCGGCAAGACCGTC
TCTGGTGGCCGCGTCGCTGCTCTCATCAAGATGGCCTACTCCAGCAAGGCCGGTGTGACTACCAAGATCACCGTT
CGGGCAGAAGAAGAGGGCGTCGCCGCCGCTGTGATTGCTTCTGTGTCTTAA
Transcript >Pro_DTO377G3_2|g2662.t1
ATGAGTTACATGAAGAAAAACGAAGATGAGGACCAGGTCATGATCAAGCTTGATCGGACCTCCGTTTTCCAAGAT
GCACGCCTATTCAATTCCTCTCCTATCTCGCCGCGAACATGCCGAACGTTACTCACCAAGATCGCTGTCCTCATG
TTCACCGGGGAGCAGTTCCCTACGAATGAAGCCACCACTCTCTTCTTCGGAATCTCCAAGCTCTTCCAGAACAAA
GACCCGTCATTGCGGCAGATGGTGTACCTGATCTTGAAGGAGCTAGCTGGCACCGCCGAAGATGTGATCATGTCG
ACAAGTATCATTATGAAGGACACTGCGGTAGGAAGCGATGTCTTGTACCGGGCCAATGCCATCAGAGCGCTCTGC
CGCATTATCGATGGTTCCACAGTACAGGGTATCGAGCGACTTATCAAGACCGCCATTGTTGACAAGACCCCGTCG
GTGTCCTCCGCGGCCTTGGTCTCTTCCTACCATCTCCTCCCCATTGCGCGCGACGTTGTCCGGAGGTGGCAGAGC
GAAACACAGGAAGCGGCCTCGTCATCGAAATCATCGACCGGGTTCCTTGGTTTCTCAGGCTCACAGAGCCATGCT
ATCTCGAACTCGAATTTCATGACACAGTACCACGCCATCGGTCTTTTGTACCAGATGCGCTCGCACGATCGCATG
TCTTTGGTCAAAATGGTACAACAGTACGGCGCTGCAGGTGTGGTGAAGAGCCCGGCTGCTCTGGTTTTGTTGGTA
CGTCTGGCGGCCAAATTGGCCGAGGAGGACCAAGGTCTCCGGAAACCCATGATGCAGATGTTGGATGGCTGGCTC
CGCCACAAGCATGAGATGGTCAACTTTGAGGCGGCCAAGGCTATTTGCGATATGCGCGATGTCACCGATGCCGAG
GCAACGCAGGCAGTTCATGTTCTCCAGCTCTTCCTGTCCTCCCCCCGGTCAATCACCAAGTTCGCTGCAATCCGT
ATCCTACACAACTTCGCCTCTTTCAAGCCACACGTCGTCAATGTCTGCAACCCTGATATCGAGTCCCTTATCTCT
AACTCGAACCGTTCAATCGCAACGTTCGCCATTACGACACTGCTCAAGACTGGCAACGAAGCCAGCGTTGACCGT
TTGATGAAGCAAATCTCGGGCTTTATGGCTGATATCACCGACGAGTTCAAGGTCACTATTGTCGAAGCTATTCGC
ACTTTGTGTTTGAAGTTCCCCAGCAAGCAGGCCGGTATGCTCGTTTTCCTGAGTGGTATCCTGCGGGACGAGGGC
GGATACGAGTTCAAGCGCACTGTTGTTGAGAGCATGTTCGATTTGATCAAGTTTGTCCCGGAAAGCAAGGAAGAT
GCGCTTGCTCACCTCTGTGAGTTCATTGAGGATTGCGAGTTCACCAAGCTTTCGGTTAGAATCCTGCACCTGCTT
GGTTCCGAGGGCCCTAAGACTACCCATCCTACAAAGTATATCCGCTACATCTACAACCGCGTCGTATTGGAGAAC
GCCATCGTACGCGCCGCTGCTGTCACCGCATTGGCCAAATTTGGTGTTGGCCAGAAAGACCCCGAAGTCAAGTCT
AGTGTCCATGTTCTCCTCACCCGTTGTCTTGATGATACCGACGACGAGGTGCGAGACCGTGCTGCGCTTAACCTG
CGTCTGATGAGTGAAGACGATGAGTCGGCGAGCGCTTTCATTAAGAACGACTCAATGTATTCCCTTTCCACGTTT
GAACACCAGCTCGTCATGTATGTGACGTCTGGTGACAAGGGGACATTCGCTACTGCCTTCGATGTTGCCACCATT
CCGGTTGTCTCACACGAGCAGGCGCTGGCCGAGGAGAGGACCAAGAAGCTTACCTCAGCTACTCCCACTCTCAAG
GCGCCTTCGACCGGTCCCCCGAAGGGCAAGGCAGCCGGCGGTATGGCCGAAGCAGCCAGCGCCTCTGCCACCCAG
AAATACGCAGAGCAACTTCTGCAGTACCCCGATATCAAGGCTTACGGTATTTTGCTCAAGTCCTCCGCGCCTGTC
GAGCTTTCCGAGAGCGAAACCGAATACGTTGTTACGGCCGTCAAGCACATTTTCAAGGAACACATCGTGGTACAA
TATGATATCAAGAACACACTTCCGGATACTATTCTTGAGAATGTCACCGTGGTTGCCACGCCAGAAGAAGAGGAC
GTATTGGAGGAAGACTTTATCATTCCTGCCCCCAAGCTGCCCACAGACCAGCCTGGTGTTGTCTACGTTGCTTTC
AAGAAGCTCACCGGCGAGAACAGCGTCCCCGTCACCTCCTTCACAAACATCCTCAAGTTCACTAGCAAAGAAATC
GATCCCGTAAGCGGCGAGCCGGAGGACAGTGGCTACGACGACGAGTACCAGGTGGAGGACCTCGAGCTGACAGGC
AGTGACTATGTCATCCCGACATTCGCCGGCAGCTTCGACCACGTCTGGGAGCAGACTGGCGCCAATGGCGAGGAG
GAAAGCGAAACTCTGCAGCTCAGCAACATGAAGGGTATCAACGATGCCACGGAACAACTGATCTCAGCGCTATCT
CTGCAACCTCTAGAGGGTACCGACGTGGCCCTCAACAGCAGCACACACACTCTCAAGCTGTTCGGCAAGACCGTC
TCTGGTGGCCGCGTCGCTGCTCTCATCAAGATGGCCTACTCCAGCAAGGCCGGTGTGACTACCAAGATCACCGTT
CGGGCAGAAGAAGAGGGCGTCGCCGCCGCTGTGATTGCTTCTGTGTCTTAA
Gene >Pro_DTO377G3_2|g2662.t1
ATGAGTTACATGAAGAAAAACGAAGATGAGGACCAGGTCATGATCAAGCTTGATCGGACCTCCGTTTTCCAAGAT
GGTGTGTAATGAACAATACCCCCTGGCGCCTACATGCGCTGCACATATTCAATGCTAACGAGATAACTCTCCTAG
CACGCCTATTCAATTCCTCTCCTATCTCGCCGCGAACATGCCGAACGTTACTCACCAAGATCGCTGTCCTCATGT
TCACCGGGGAGCAGTTCCCTACGAATGAAGCCACCACTCTCTTCTTCGGAATCTCCAAGCTCTTCCAGAACAAAG
ACCCGTCATTGCGGCAGATGGTGTACCTGATCTTGAAGGAGCTAGCTGGCACCGCCGAAGATGTGATCATGTCGA
CAAGTATCATTATGAAGGACACTGCGGTAGGAAGCGATGTCTTGTACCGGGCCAATGCCATCAGAGCGCTCTGCC
GCATTATCGATGTAGGTCGTCGGTCGCGAGGACTTCAATGGTTGAGGGGATTTGCTGACAATTGCAAAAGGGTTC
CACAGTACAGGGTATCGAGCGACTTATCAAGACCGCCATTGTTGACAAGACCCCGTCGGTGTCCTCCGCGGCCTT
GGTCTCTTCCTACCATCTCCTCCCCATTGCGCGCGACGTTGTCCGGAGGTGGCAGAGCGAAACACAGGAAGCGGC
CTCGTCATCGAAATCATCGACCGGGTTCCTTGGTTTCTCAGGCTCACAGAGCCATGCTATCTCGAACTCGAATTT
CATGACACAGTACCACGCCATCGGTCTTTTGTACCAGATGCGCTCGCACGATCGCATGTCTTTGGTCAAAATGGT
ACAACAGTACGGCGCTGCAGGTGTGGTGAAGAGCCCGGCTGCTCTGGTTTTGTTGGTACGTCTGGCGGCCAAATT
GGCCGAGGAGGACCAAGGTCTCCGGAAACCCATGATGCAGATGTTGGATGGCTGGCTCCGCCACAAGCATGAGAT
GGTCAACTTTGAGGCGGCCAAGGCTATTTGCGATATGCGCGATGTCACCGATGCCGAGGCAACGCAGGCAGTTCA
TGTTCTCCAGCTCTTCCTGTCCTCCCCCCGGTCAATCACCAAGTTCGCTGCAATCCGTATCCTACACAACTTCGC
CTCTTTCAAGCCACACGTCGTCAATGTCTGCAACCCTGATATCGAGTCCCTTATCTCTAACTCGAACCGTTCAAT
CGCAACGTTCGCCATTACGACACTGCTCAAGACTGGCAACGAAGCCAGCGTTGACCGTTTGATGAAGCAAATCTC
GGGCTTTATGGCTGATATCACCGACGAGTTCAAGGTCACTATTGTCGAAGCTATTCGCACTTTGTGTTTGAAGTT
CCCCAGCAAGCAGGCCGGTATGCTCGTTTTCCTGAGTGGTATCCTGCGGGACGAGGGCGGATACGAGTTCAAGCG
CACTGTTGTTGAGAGCATGTTCGATTTGATCAAGTTTGTCCCGGAAAGCAAGGAAGATGCGCTTGCTCACCTCTG
TGAGTTCATTGAGGATTGCGAGTTCACCAAGCTTTCGGTTAGAATCCTGCACCTGCTTGGTTCCGAGGGCCCTAA
GACTACCCATCCTACAAAGTATATCCGCTACATCTACAACCGCGTCGTATTGGAGAACGCCATCGTACGCGCCGC
TGCTGTCACCGCATTGGCCAAATTTGGTGTTGGCCAGAAAGACCCCGAAGTCAAGTCTAGTGTCCATGTTCTCCT
CACCCGTTGTCTTGATGATACCGACGACGAGGTGCGAGACCGTGCTGCGCTTAACCTGCGTCTGATGAGTGAAGA
CGATGAGTCGGCGAGCGCTTTCATTAAGAACGGTAAGGTCTTGTCCATGACTAGCAATGGTAATTTTACTAATGG
TTATAGACTCAATGTATTCCCTTTCCACGTTTGAACACCAGCTCGTCATGTATGTGACGTCTGGTGACAAGGGGA
CATTCGCTACTGCCTTCGATGTTGCCACCATTCCGGTTGTCTCACACGAGCAGGCGCTGGCCGAGGAGAGGACCA
AGAAGCTTACCTCAGCTACTCCCACTCTCAAGGCGCCTTCGACCGGTCCCCCGAAGGGCAAGGCAGCCGGCGGTA
TGGCCGAAGCAGCCAGCGCCTCTGCCACCCAGAAATACGCAGAGCAACTTCTGCAGTACCCCGATATCAAGGCTT
ACGGTATTTTGCTCAAGTCCTCCGCGCCTGTCGAGCTTTCCGAGAGCGAAACCGAATACGTTGTTACGGCCGTCA
AGCACATTTTCAAGGAACACATCGTGGTACAATATGATATCAAGAACACACTTCCGGATACTATTCTTGAGAATG
TCACCGTGGTTGCCACGCCAGAAGAAGAGGACGTATTGGAGGAAGACTTTATCATTCCTGCCCCCAAGCTGCCCA
CAGACCAGCCTGGTGTTGTCTACGTTGCTTTCAAGAAGCTCACCGGCGAGAACAGCGTCCCCGTCACCTCCTTCA
CAAACATCCTCAAGTTCACTAGCAAAGAAATCGATCCCGTAAGCGGCGAGCCGGAGGACAGTGGCTACGACGACG
AGTACCAGGTGGAGGACCTCGAGCTGACAGGCAGTGACTATGTCATCCCGACATTCGCCGGCAGCTTCGACCACG
TCTGGGAGCAGACTGGCGCCAATGGCGAGGAGGAAAGCGAAACTCTGCAGCTCAGCAACATGAAGGGTATCAACG
GTATGTACAAGTCCTATTTATTGCTCTATGTTATAAATACTCACGCTTTTGATCCCAGATGCCACGGAACAACTG
ATCTCAGCGCTATCTCTGCAACCTCTAGAGGGTACCGACGTGGCCCTCAACAGCAGCACACACACTCTCAAGCTG
TTCGGCAAGACCGTCTCTGGTGGCCGCGTCGCTGCTCTCATCAAGATGGCCTACTCCAGCAAGGCCGGTGTGACT
ACCAAGATCACCGTTCGGGCAGAAGAAGAGGGCGTCGCCGCCGCTGTGATTGCTTCTGTGTCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail