Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2655.t1
Gene name
Locationscaffold_03:599202..601921
Strand-
Gene length (bp)2719
Transcript length (bp)2661
Coding sequence length (bp)2661
Protein length (aa) 887

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 4.5E-12 743 787
PF12678 zf-rbx1 RING-H2 zinc finger domain 1.8E-08 756 787
PF17123 zf-RING_11 RING-like zinc finger 5.9E-09 743 772
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 5.3E-08 743 786
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 5.8E-08 744 786
PF02225 PA PA domain 1.3E-07 217 290
PF14634 zf-RING_5 zinc-RING finger domain 5.2E-07 743 787

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0008270 zinc ion binding Yes
GO:0046914 transition metal ion binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 615 637 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 181.66 105.43 257.90
5d_25C Five days - 25 degrees Celsius 248.64 139.12 358.15
7d_25C Seven days - 25 degrees Celsius 228.49 128.96 328.02
10d_25C Ten days - 25 degrees Celsius 328.41 178.83 477.99
7d_15C Seven days - 15 degrees Celsius 281.23 150.67 411.79
7d_30C Seven days - 30 degrees Celsius 243.87 136.25 351.49

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.221434 no
3d_25C 7d_25C 0.383931 no
3d_25C 7d_15C 0.072957 no
3d_25C 7d_30C 0.250218 no
3d_25C 10d_25C 0.009770 yes
5d_25C 7d_25C 0.797014 no
5d_25C 7d_15C 0.710144 no
5d_25C 7d_30C 0.960211 no
5d_25C 10d_25C 0.303848 no
7d_25C 7d_15C 0.466211 no
7d_25C 7d_30C 0.851769 no
7d_25C 10d_25C 0.134199 no
7d_15C 7d_30C 0.651416 no
7d_15C 10d_25C 0.613658 no
7d_30C 10d_25C 0.260832 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2655.t1
MRPPRLLIVLFCLIFFPILLTFFSALTSPDVAPNTLAGQKTGLRALFSFNIPSSLFPPSAIISLTDDNSTFFLAR
PAAFGSLLPTKGLSGQLWVGSGFGEGGLAGGVEGELGCSDIPGWGESKNHKKQDKTSRAAEQSSGISGGSTVNDQ
SSNRPRSVSQVDTTQNDRDSTTPPLTNDGTDDHLHHPLPESGSSNPGMNQKYGDYVQNKPPAHADIQSLQETAEI
QGKVVLLSRGGCGFLEKAKWAQRRGGIALIVGDDTRGGNLVTMYARGDTSNVTIPALFTSHTTAHLLSSLVPGHT
GGTAGLEDVVKSSQAKLAGQAEADKERVATTTATTTFPSPTASSHSTTKEKPAPSSHSEGGVFRAIGAFLGLCDK
NGGSRRLEDSRRPPSSGNIDWINLGSRNEKEAPSSAWRRSTDLNHHGRAKVDDTFDKHKADMSTEGLEDDDFVIG
VQDWRDPDLMPPKSSTHPTTSIPATGKDTSKTASADKDASSSPNGLQGGSITPGSGEYQSFEKSSAGSHDTHRKG
SEKETIGTHGKSRSSSTKGWFSSHFGWGDDTQQDPQPSSSPSLQKSIATNEQKQNNAPTSSRLSAESSEHEGLWV
TMTPTSMSTSPFFDTLLVLVVSPLLTLTVVYALLLIRSRIRRRRWRAPKSVIERLPVRTYHTIATTSSSSSNSTR
PSSPSPLSPTSPLLGTDSRPSASRSNRSRSQTFSGTILDSSVVPKEEKCNLQGGSTLWRRKYTGRQVECVVCLEE
YIDGQSRVMSLPCGHEFHVECITPWLTTRRRTCPICKGDVVRSLAHCQSGDSRGHREQSLDDVRSVQSISRGSAS
SAPVPIEGVNDDASDTEQNAGLPGDHANSAPQSSWRNLATLSFSALSGDTIWHQARADRNR*
Coding >Pro_DTO377G3_2|g2655.t1
ATGCGACCGCCACGCCTGCTCATCGTACTCTTCTGCCTTATCTTCTTCCCGATCCTCCTCACCTTCTTTTCCGCG
CTTACATCACCCGATGTAGCTCCTAATACTCTCGCTGGTCAGAAAACTGGGCTGCGAGCTTTGTTTTCTTTTAAC
ATACCATCGTCCCTTTTTCCCCCGTCGGCTATTATCAGTCTCACCGATGACAACTCGACCTTCTTTCTCGCCCGA
CCAGCGGCATTTGGCTCCCTACTGCCAACCAAAGGCCTTAGCGGTCAGCTATGGGTGGGAAGTGGCTTTGGTGAG
GGGGGATTAGCTGGTGGTGTGGAAGGAGAACTGGGCTGCTCCGATATCCCCGGCTGGGGTGAGAGCAAAAATCAT
AAGAAACAAGATAAAACCTCTAGAGCCGCGGAGCAGAGTTCCGGGATCTCCGGGGGAAGTACAGTGAATGATCAA
TCCTCAAACCGCCCGCGGTCGGTGTCGCAGGTCGATACTACGCAGAACGATAGAGATTCAACTACCCCGCCTTTG
ACGAACGATGGCACTGACGACCATCTACACCATCCACTCCCTGAATCTGGTTCTTCTAACCCCGGGATGAATCAG
AAATATGGAGATTACGTCCAAAATAAGCCGCCTGCGCATGCCGACATCCAATCGCTACAGGAAACTGCCGAAATC
CAGGGTAAAGTAGTGCTGTTGAGTCGGGGTGGCTGTGGGTTTTTGGAGAAGGCCAAATGGGCACAACGACGAGGA
GGGATTGCTTTGATCGTCGGCGATGATACCCGGGGTGGCAACTTGGTCACTATGTACGCACGAGGCGATACATCG
AACGTCACGATCCCGGCCTTGTTCACATCTCACACTACTGCTCATCTTCTATCGTCATTGGTTCCTGGGCATACA
GGTGGAACTGCCGGTTTAGAAGATGTAGTAAAATCATCACAAGCGAAGCTGGCAGGACAAGCTGAAGCCGATAAA
GAACGGGTGGCAACTACTACCGCAACAACAACTTTTCCTAGTCCGACTGCCAGCAGCCATTCGACAACCAAGGAG
AAACCTGCACCCTCTTCTCACTCGGAAGGCGGGGTTTTCCGTGCAATTGGTGCATTCTTGGGATTGTGCGATAAG
AACGGAGGTTCGCGACGTCTAGAAGACAGCCGACGTCCGCCTAGCAGCGGCAACATTGATTGGATCAACCTAGGC
TCACGGAATGAAAAAGAAGCCCCGTCGAGCGCTTGGAGGAGATCAACAGATCTCAATCATCATGGTCGGGCCAAG
GTAGACGACACATTCGACAAGCACAAGGCCGACATGTCCACTGAAGGTCTTGAGGATGATGACTTTGTCATCGGG
GTTCAGGACTGGAGAGATCCTGACTTGATGCCCCCTAAGAGTAGCACCCATCCGACAACTAGCATCCCTGCAACT
GGCAAGGATACCTCCAAGACTGCCAGTGCGGATAAAGATGCCTCTTCCTCGCCCAACGGTCTTCAGGGTGGTAGC
ATCACACCAGGAAGTGGAGAATACCAGAGCTTCGAGAAATCCAGTGCTGGTTCTCATGACACGCACCGCAAGGGG
TCTGAGAAAGAAACCATCGGAACTCATGGGAAGTCCAGATCTTCTTCCACGAAGGGCTGGTTCTCGAGTCACTTT
GGATGGGGAGATGATACTCAGCAAGACCCTCAGCCTTCTTCGTCGCCTTCACTCCAGAAAAGTATTGCAACCAAC
GAGCAGAAACAAAACAACGCTCCCACATCAAGCCGTCTCAGCGCGGAGTCTTCCGAACACGAAGGTCTTTGGGTT
ACAATGACACCTACCAGCATGTCCACCAGCCCCTTTTTCGATACTCTATTGGTACTTGTCGTCAGCCCTTTGCTC
ACACTGACGGTGGTTTATGCCCTTTTGCTGATCCGGTCTCGAATCCGCCGTCGTCGCTGGCGTGCCCCGAAGTCG
GTTATCGAACGACTTCCTGTCCGAACCTACCACACAATTGCCACCACTTCGTCCTCGTCTTCCAACTCAACGCGC
CCCTCCAGTCCCAGTCCTCTATCCCCGACTTCTCCACTCCTTGGCACAGATAGCCGACCAAGCGCATCCCGATCC
AATAGATCACGTTCACAAACATTCTCGGGCACTATACTAGACTCATCTGTCGTACCCAAAGAAGAGAAGTGCAAC
CTGCAAGGTGGATCTACCTTGTGGCGACGGAAGTACACAGGAAGGCAGGTGGAGTGTGTCGTATGTCTTGAGGAA
TACATCGATGGTCAGAGCCGGGTCATGAGTTTGCCATGTGGCCATGAATTCCATGTGGAATGCATTACCCCCTGG
TTGACCACTCGTCGACGAACTTGTCCAATCTGTAAGGGCGATGTTGTCCGTTCGTTGGCTCATTGTCAATCCGGC
GATTCTCGGGGTCATCGTGAGCAGTCTCTTGATGATGTTCGCAGCGTCCAGTCAATCTCTAGAGGCAGCGCATCT
TCCGCTCCAGTACCAATTGAGGGCGTCAATGACGATGCTTCAGATACGGAACAAAATGCAGGTCTACCTGGCGAC
CATGCAAATTCTGCCCCACAGTCAAGCTGGCGAAACCTCGCTACCCTTAGCTTTTCTGCTCTGAGTGGCGACACC
ATATGGCACCAGGCTCGCGCAGACCGCAATCGCTAA
Transcript >Pro_DTO377G3_2|g2655.t1
ATGCGACCGCCACGCCTGCTCATCGTACTCTTCTGCCTTATCTTCTTCCCGATCCTCCTCACCTTCTTTTCCGCG
CTTACATCACCCGATGTAGCTCCTAATACTCTCGCTGGTCAGAAAACTGGGCTGCGAGCTTTGTTTTCTTTTAAC
ATACCATCGTCCCTTTTTCCCCCGTCGGCTATTATCAGTCTCACCGATGACAACTCGACCTTCTTTCTCGCCCGA
CCAGCGGCATTTGGCTCCCTACTGCCAACCAAAGGCCTTAGCGGTCAGCTATGGGTGGGAAGTGGCTTTGGTGAG
GGGGGATTAGCTGGTGGTGTGGAAGGAGAACTGGGCTGCTCCGATATCCCCGGCTGGGGTGAGAGCAAAAATCAT
AAGAAACAAGATAAAACCTCTAGAGCCGCGGAGCAGAGTTCCGGGATCTCCGGGGGAAGTACAGTGAATGATCAA
TCCTCAAACCGCCCGCGGTCGGTGTCGCAGGTCGATACTACGCAGAACGATAGAGATTCAACTACCCCGCCTTTG
ACGAACGATGGCACTGACGACCATCTACACCATCCACTCCCTGAATCTGGTTCTTCTAACCCCGGGATGAATCAG
AAATATGGAGATTACGTCCAAAATAAGCCGCCTGCGCATGCCGACATCCAATCGCTACAGGAAACTGCCGAAATC
CAGGGTAAAGTAGTGCTGTTGAGTCGGGGTGGCTGTGGGTTTTTGGAGAAGGCCAAATGGGCACAACGACGAGGA
GGGATTGCTTTGATCGTCGGCGATGATACCCGGGGTGGCAACTTGGTCACTATGTACGCACGAGGCGATACATCG
AACGTCACGATCCCGGCCTTGTTCACATCTCACACTACTGCTCATCTTCTATCGTCATTGGTTCCTGGGCATACA
GGTGGAACTGCCGGTTTAGAAGATGTAGTAAAATCATCACAAGCGAAGCTGGCAGGACAAGCTGAAGCCGATAAA
GAACGGGTGGCAACTACTACCGCAACAACAACTTTTCCTAGTCCGACTGCCAGCAGCCATTCGACAACCAAGGAG
AAACCTGCACCCTCTTCTCACTCGGAAGGCGGGGTTTTCCGTGCAATTGGTGCATTCTTGGGATTGTGCGATAAG
AACGGAGGTTCGCGACGTCTAGAAGACAGCCGACGTCCGCCTAGCAGCGGCAACATTGATTGGATCAACCTAGGC
TCACGGAATGAAAAAGAAGCCCCGTCGAGCGCTTGGAGGAGATCAACAGATCTCAATCATCATGGTCGGGCCAAG
GTAGACGACACATTCGACAAGCACAAGGCCGACATGTCCACTGAAGGTCTTGAGGATGATGACTTTGTCATCGGG
GTTCAGGACTGGAGAGATCCTGACTTGATGCCCCCTAAGAGTAGCACCCATCCGACAACTAGCATCCCTGCAACT
GGCAAGGATACCTCCAAGACTGCCAGTGCGGATAAAGATGCCTCTTCCTCGCCCAACGGTCTTCAGGGTGGTAGC
ATCACACCAGGAAGTGGAGAATACCAGAGCTTCGAGAAATCCAGTGCTGGTTCTCATGACACGCACCGCAAGGGG
TCTGAGAAAGAAACCATCGGAACTCATGGGAAGTCCAGATCTTCTTCCACGAAGGGCTGGTTCTCGAGTCACTTT
GGATGGGGAGATGATACTCAGCAAGACCCTCAGCCTTCTTCGTCGCCTTCACTCCAGAAAAGTATTGCAACCAAC
GAGCAGAAACAAAACAACGCTCCCACATCAAGCCGTCTCAGCGCGGAGTCTTCCGAACACGAAGGTCTTTGGGTT
ACAATGACACCTACCAGCATGTCCACCAGCCCCTTTTTCGATACTCTATTGGTACTTGTCGTCAGCCCTTTGCTC
ACACTGACGGTGGTTTATGCCCTTTTGCTGATCCGGTCTCGAATCCGCCGTCGTCGCTGGCGTGCCCCGAAGTCG
GTTATCGAACGACTTCCTGTCCGAACCTACCACACAATTGCCACCACTTCGTCCTCGTCTTCCAACTCAACGCGC
CCCTCCAGTCCCAGTCCTCTATCCCCGACTTCTCCACTCCTTGGCACAGATAGCCGACCAAGCGCATCCCGATCC
AATAGATCACGTTCACAAACATTCTCGGGCACTATACTAGACTCATCTGTCGTACCCAAAGAAGAGAAGTGCAAC
CTGCAAGGTGGATCTACCTTGTGGCGACGGAAGTACACAGGAAGGCAGGTGGAGTGTGTCGTATGTCTTGAGGAA
TACATCGATGGTCAGAGCCGGGTCATGAGTTTGCCATGTGGCCATGAATTCCATGTGGAATGCATTACCCCCTGG
TTGACCACTCGTCGACGAACTTGTCCAATCTGTAAGGGCGATGTTGTCCGTTCGTTGGCTCATTGTCAATCCGGC
GATTCTCGGGGTCATCGTGAGCAGTCTCTTGATGATGTTCGCAGCGTCCAGTCAATCTCTAGAGGCAGCGCATCT
TCCGCTCCAGTACCAATTGAGGGCGTCAATGACGATGCTTCAGATACGGAACAAAATGCAGGTCTACCTGGCGAC
CATGCAAATTCTGCCCCACAGTCAAGCTGGCGAAACCTCGCTACCCTTAGCTTTTCTGCTCTGAGTGGCGACACC
ATATGGCACCAGGCTCGCGCAGACCGCAATCGCTAA
Gene >Pro_DTO377G3_2|g2655.t1
ATGCGACCGCCACGCCTGCTCATCGTACTCTTCTGCCTTATCTTCTTCCCGATCCTCCTCACCTTCTTTTCCGCG
CTTACATCACCCGATGTAGCTCCTAATACTCTCGCTGGTCAGAAAACTGGGCTGCGAGCTTTGTTTTCTTTTAAC
ATACCATCGTCCCTTTTTCCCCCGTCGGCTATTATCAGTCTCACCGATGACAACTCGACCTTCTTTCTCGCCCGA
CCAGCGGCATTTGGCTCCCTACTGCCAACCAAAGGCCTTAGCGGTCAGCTATGGGTGGGAAGTGGCTTTGGTGAG
GGGGGATTAGCTGGTGGTGTGGAAGGAGAACTGGGCTGCTCCGATATCCCCGGCTGGGGTGAGAGCAAAAATCAT
AAGAAACAAGATAAAACCTCTAGAGCCGCGGAGCAGAGTTCCGGGATCTCCGGGGGAAGTACAGTGAATGATCAA
TCCTCAAACCGCCCGCGGTCGGTGTCGCAGGTCGATACTACGCAGAACGATAGAGATTCAACTACCCCGCCTTTG
ACGAACGATGGCACTGACGACCATCTACACCATCCACTCCCTGAATCTGGTTCTTCTAACCCCGGGATGAATCAG
AAATATGGAGATTACGTCCAAAATAAGCCGCCTGCGCATGCCGACATCCAATCGCTACAGGAAACTGCCGAAATC
CAGGGTAAAGTAGTGCTGTTGAGTCGGGGTGGCTGTGGGTTTTTGGAGAAGGCCAAATGGGCACAACGACGAGGA
GGGATTGCTTTGATCGTCGGCGATGATACCCGGGGTGGCAACTTGGTCACTATGTACGCACGAGGCGATACATCG
AACGTCACGATCCCGGCCTTGTTCACATCTCACACTACTGCTCATCTTCTATCGTCATTGGTTCCTGGGCATACA
GGTGGAACTGCCGGTTTAGAAGATGTAGTAAAATCATCACAAGCGAAGCTGGCAGGACAAGCTGAAGCCGATAAA
GAACGGGTGGCAACTACTACCGCAACAACAACTTTTCCTAGTCCGACTGCCAGCAGCCATTCGACAACCAAGGAG
AAACCTGCACCCTCTTCTCACTCGGAAGGCGGGGTTTTCCGTGCAATTGGTGCATTCTTGGGATTGTGCGATAAG
AACGGAGGTTCGCGACGTCTAGAAGACAGCCGACGTCCGCCTAGCAGCGGCAACATTGATTGGATCAACCTAGGC
TCACGGAATGAAAAAGAAGCCCCGTCGAGCGCTTGGAGGAGATCAACAGATCTCAATCATCATGGTCGGGCCAAG
GTAGACGACACATTCGACAAGCACAAGGCCGACATGTCCACTGAAGGTCTTGAGGATGATGACTTTGTCATCGGG
GTTCAGGACTGGAGAGATCCTGACTTGATGCCCCCTAAGAGTAGCACCCATCCGACAACTAGCATCCCTGCAACT
GGCAAGGATACCTCCAAGACTGCCAGTGCGGATAAAGATGCCTCTTCCTCGCCCAACGGTCTTCAGGGTGGTAGC
ATCACACCAGGAAGTGGAGAATACCAGAGCTTCGAGAAATCCAGTGCTGGTTCTCATGACACGCACCGCAAGGGG
TCTGAGAAAGAAACCATCGGAACTCATGGGAAGTCCAGATCTTCTTCCACGAAGGGCTGGTTCTCGAGTCACTTT
GGATGGGGAGATGATACTCAGCAAGACCCTCAGCCTTCTTCGTCGCCTTCACTCCAGAAAAGTATTGCAACCAAC
GAGCAGAAACAAAACAACGCTCCCACATCAAGCCGTCTCAGCGCGGAGTCTTCCGAACACGAAGGTCTTTGGGTT
ACAATGACACCTACCAGCATGTCCACCAGCCCCTTTTTCGATACTCTATTGGTACTTGTCGTCAGCCCTTTGCTC
ACACTGACGGTGGTTTATGCCCTTTTGCTGATCCGGTCTCGAATCCGCCGTCGTCGCTGGCGTGCCCCGAAGTCG
GTTATCGAACGACTTCCTGTCCGAACCTACCACACAATTGCCACCACTTCGTCCTCGTCTTCCAACTCAACGCGC
CCCTCCAGTCCCAGTCCTCTATCCCCGACTTCTCCACTCCTTGGCACAGATAGCCGACCAAGCGCATCCCGATCC
AATAGATCACGTTCACAAACATTCTCGGGCACTATACTAGACTCATCTGTCGTACCCAAAGAAGAGAAGTGCAAC
CTGCAAGGTGGATCTACCTTGTGGCGACGGAAGTACACAGGAAGGCAGGTGGAGTGTGTCGTATGTCTTGAGGAA
TACATCGATGGTCAGAGCCGGGTCATGAGTTTGCCATGTGGCCATGAATTCCATGTGGAATGCATGTAAGTGACG
TGAATTTTTTTGTCTTGGTTGCGAAGTTTTACTAACCTCTTTTCTCAGTACCCCCTGGTTGACCACTCGTCGACG
AACTTGTCCAATCTGTAAGGGCGATGTTGTCCGTTCGTTGGCTCATTGTCAATCCGGCGATTCTCGGGGTCATCG
TGAGCAGTCTCTTGATGATGTTCGCAGCGTCCAGTCAATCTCTAGAGGCAGCGCATCTTCCGCTCCAGTACCAAT
TGAGGGCGTCAATGACGATGCTTCAGATACGGAACAAAATGCAGGTCTACCTGGCGACCATGCAAATTCTGCCCC
ACAGTCAAGCTGGCGAAACCTCGCTACCCTTAGCTTTTCTGCTCTGAGTGGCGACACCATATGGCACCAGGCTCG
CGCAGACCGCAATCGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail