Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2650.t1
Gene name
Locationscaffold_03:587978..588624
Strand+
Gene length (bp)646
Transcript length (bp)339
Coding sequence length (bp)339
Protein length (aa) 113

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10247 Romo1 Reactive mitochondrial oxygen species modulator 1 9.5E-28 18 83

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.5

Transmembrane Domains

Domain # Start End Length
1 25 47 22
2 59 81 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 311.73 178.18 445.28
5d_25C Five days - 25 degrees Celsius 326.00 186.46 465.54
7d_25C Seven days - 25 degrees Celsius 320.82 184.09 457.55
10d_25C Ten days - 25 degrees Celsius 429.00 257.41 600.58
7d_15C Seven days - 15 degrees Celsius 326.66 188.41 464.91
7d_30C Seven days - 30 degrees Celsius 323.25 184.85 461.65

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.904691 no
3d_25C 7d_25C 0.939159 no
3d_25C 7d_15C 0.900861 no
3d_25C 7d_30C 0.922915 no
3d_25C 10d_25C 0.181913 no
5d_25C 7d_25C 0.968574 no
5d_25C 7d_15C 0.996134 no
5d_25C 7d_30C 0.983643 no
5d_25C 10d_25C 0.269079 no
7d_25C 7d_15C 0.964926 no
7d_25C 7d_30C 0.985642 no
7d_25C 10d_25C 0.232457 no
7d_15C 7d_30C 0.978911 no
7d_15C 10d_25C 0.268759 no
7d_30C 10d_25C 0.245676 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2650.t1
MPVVAGPPAQAGPGGAPSTLEKMKMGCLMGSTVGGIMGFIIGTVTIFQYGAGPNGVMRTLGKYMLGSGATFGLFM
SIGSVIRSEGPHNDAWLRARGPPMMLPRQSPLRPMRQ*
Coding >Pro_DTO377G3_2|g2650.t1
ATGCCTGTGGTTGCCGGACCTCCCGCTCAAGCGGGCCCAGGGGGTGCTCCCTCAACTTTGGAGAAGATGAAAATG
GGCTGCCTGATGGGTTCCACTGTTGGTGGTATCATGGGCTTCATTATTGGAACTGTGACGATCTTCCAATATGGC
GCTGGCCCCAACGGTGTTATGCGGACTCTCGGCAAGTATATGCTAGGTTCAGGCGCCACTTTCGGACTCTTCATG
TCCATCGGTAGCGTCATCCGCTCTGAAGGACCTCACAACGATGCCTGGCTTCGTGCTCGGGGCCCCCCAATGATG
CTCCCCCGACAGAGTCCCCTCCGGCCAATGCGCCAGTGA
Transcript >Pro_DTO377G3_2|g2650.t1
ATGCCTGTGGTTGCCGGACCTCCCGCTCAAGCGGGCCCAGGGGGTGCTCCCTCAACTTTGGAGAAGATGAAAATG
GGCTGCCTGATGGGTTCCACTGTTGGTGGTATCATGGGCTTCATTATTGGAACTGTGACGATCTTCCAATATGGC
GCTGGCCCCAACGGTGTTATGCGGACTCTCGGCAAGTATATGCTAGGTTCAGGCGCCACTTTCGGACTCTTCATG
TCCATCGGTAGCGTCATCCGCTCTGAAGGACCTCACAACGATGCCTGGCTTCGTGCTCGGGGCCCCCCAATGATG
CTCCCCCGACAGAGTCCCCTCCGGCCAATGCGCCAGTGA
Gene >Pro_DTO377G3_2|g2650.t1
ATGCCTGTGGTTGCCGGACCTCCCGCTCAAGCGGGCCCAGGGGGTGCTCCCTCAACTTTGGAGAAGAGTATGTCA
TCTACAACCTAGTGATATAGATCACCCTCCGCGTGGTGTCCTTTTTCCTTGGGTACTATATATATATGGTGAACC
AAGTATGCTGACATATTCCTAGTGAAAATGGGCTGCCTGATGGGTTCCAGTACGTGATCACAAAACAACCGAGCC
TTGTTCACCAAGAGCTTTTGCTAACATAGCTCCCCTTTCAGCTGTTGGTGGTATCATGGGCTTCATTATTGGTTG
GTCCCACTTAGTCCCCGAATGAAGGTGTGCATGATAAGCTAACTGAAACAGGAACTGTGACGATCTTCCAATATG
GCGCTGGCCCCAACGGTGTTATGCGGACTCTCGGCAAGTATATGCTAGGTTCAGGCGCCACTTTCGGGTATGGTT
GACTCCTTGAAAGCTTTGAAGTTATACTACTTTGGTTGAGAATCACTGGCTAATCAACTTCCCTTCAAATAGACT
CTTCATGTCCATCGGTAGCGTCATCCGCTCTGAAGGACCTCACAACGATGCCTGGCTTCGTGCTCGGGGCCCCCC
AATGATGCTCCCCCGACAGAGTCCCCTCCGGCCAATGCGCCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail