Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2648.t1
Gene name
Locationscaffold_03:582911..583651
Strand+
Gene length (bp)740
Transcript length (bp)663
Coding sequence length (bp)663
Protein length (aa) 221

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12328 Rpp20 Rpp20 subunit of nuclear RNase MRP and P 4.2E-46 47 216
PF01918 Alba Alba 1.4E-17 49 141

GO

GO Term Description Terminal node
GO:0008033 tRNA processing Yes
GO:0004526 ribonuclease P activity Yes
GO:0005634 nucleus Yes
GO:0003676 nucleic acid binding Yes
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0004521 endoribonuclease activity No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0003824 catalytic activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0034470 ncRNA processing No
GO:0071704 organic substance metabolic process No
GO:0006399 tRNA metabolic process No
GO:0006396 RNA processing No
GO:1901363 heterocyclic compound binding No
GO:0004549 tRNA-specific ribonuclease activity No
GO:0090304 nucleic acid metabolic process No
GO:0016891 endoribonuclease activity, producing 5'-phosphomonoesters No
GO:0046483 heterocycle metabolic process No
GO:0043227 membrane-bounded organelle No
GO:0004540 ribonuclease activity No
GO:0044464 cell part No
GO:0043231 intracellular membrane-bounded organelle No
GO:0008150 biological_process No
GO:0044237 cellular metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0016070 RNA metabolic process No
GO:0005488 binding No
GO:0044424 intracellular part No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0006725 cellular aromatic compound metabolic process No
GO:0004518 nuclease activity No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0043170 macromolecule metabolic process No
GO:0016787 hydrolase activity No
GO:0140098 catalytic activity, acting on RNA No
GO:0008152 metabolic process No
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No
GO:0016893 endonuclease activity, active with either ribo- or deoxyribonucleic acids and producing 5'-phosphomonoesters No
GO:0043226 organelle No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0004519 endonuclease activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2648.t1
MAKGLLESKLQFEKKNKDLIRLPKHAKVEKRPIPHAPVASPYAGALVPKIVYVSKTTPFMSAVKRVQKLLLQAEK
RATANINLEDTRKNDKQILEELSKIPEKREKVFVKATGRAIEKALNVAKWFEEKETEYTVCVNTGSVVVVDDIVE
DEEIKAKEEQKRQRQQEQTPTDQGDAASKPESKSAAKKRKRQAAAVEDDAELPESRIRWIKMVEVAVSLK*
Coding >Pro_DTO377G3_2|g2648.t1
ATGGCAAAGGGGCTATTGGAAAGCAAGCTCCAGTTTGAGAAAAAGAACAAAGACCTTATTAGACTCCCAAAACAT
GCCAAAGTCGAGAAGCGTCCTATACCTCATGCCCCAGTCGCATCCCCATATGCTGGCGCATTAGTACCTAAGATT
GTCTATGTGTCTAAGACTACGCCATTCATGAGCGCCGTCAAGCGCGTCCAGAAACTCCTGCTGCAGGCCGAGAAG
CGCGCCACAGCAAACATCAATCTCGAGGATACGCGCAAGAACGATAAACAGATACTCGAGGAGTTGTCGAAGATA
CCAGAGAAGCGAGAGAAAGTTTTTGTGAAGGCGACAGGGCGGGCTATTGAGAAGGCGCTGAACGTAGCCAAATGG
TTCGAGGAAAAGGAAACCGAGTACACAGTCTGTGTCAATACGGGGAGCGTGGTTGTCGTGGATGATATCGTCGAG
GACGAAGAAATTAAAGCAAAAGAAGAACAGAAACGGCAACGGCAGCAAGAGCAAACCCCAACTGACCAGGGAGAT
GCGGCTTCTAAGCCGGAATCCAAGTCAGCCGCAAAGAAGAGGAAACGTCAGGCCGCCGCGGTAGAGGATGATGCC
GAGCTCCCCGAGAGCCGGATAAGGTGGATCAAAATGGTTGAAGTCGCCGTCAGCCTTAAGTGA
Transcript >Pro_DTO377G3_2|g2648.t1
ATGGCAAAGGGGCTATTGGAAAGCAAGCTCCAGTTTGAGAAAAAGAACAAAGACCTTATTAGACTCCCAAAACAT
GCCAAAGTCGAGAAGCGTCCTATACCTCATGCCCCAGTCGCATCCCCATATGCTGGCGCATTAGTACCTAAGATT
GTCTATGTGTCTAAGACTACGCCATTCATGAGCGCCGTCAAGCGCGTCCAGAAACTCCTGCTGCAGGCCGAGAAG
CGCGCCACAGCAAACATCAATCTCGAGGATACGCGCAAGAACGATAAACAGATACTCGAGGAGTTGTCGAAGATA
CCAGAGAAGCGAGAGAAAGTTTTTGTGAAGGCGACAGGGCGGGCTATTGAGAAGGCGCTGAACGTAGCCAAATGG
TTCGAGGAAAAGGAAACCGAGTACACAGTCTGTGTCAATACGGGGAGCGTGGTTGTCGTGGATGATATCGTCGAG
GACGAAGAAATTAAAGCAAAAGAAGAACAGAAACGGCAACGGCAGCAAGAGCAAACCCCAACTGACCAGGGAGAT
GCGGCTTCTAAGCCGGAATCCAAGTCAGCCGCAAAGAAGAGGAAACGTCAGGCCGCCGCGGTAGAGGATGATGCC
GAGCTCCCCGAGAGCCGGATAAGGTGGATCAAAATGGTTGAAGTCGCCGTCAGCCTTAAGTGA
Gene >Pro_DTO377G3_2|g2648.t1
ATGGCAAAGGGGCTATTGGAAAGCAAGCTCCAGTTTGAGAAAAAGAACAAAGACCTTATTAGACTCCCAAAACGT
GCGCCTTCCCATCCGATCGCCTAAACGGCCAATGCTGAGAACCGGGGATCACAACTGCTGACTTTTGGATAACAG
ATGCCAAAGTCGAGAAGCGTCCTATACCTCATGCCCCAGTCGCATCCCCATATGCTGGCGCATTAGTACCTAAGA
TTGTCTATGTGTCTAAGACTACGCCATTCATGAGCGCCGTCAAGCGCGTCCAGAAACTCCTGCTGCAGGCCGAGA
AGCGCGCCACAGCAAACATCAATCTCGAGGATACGCGCAAGAACGATAAACAGATACTCGAGGAGTTGTCGAAGA
TACCAGAGAAGCGAGAGAAAGTTTTTGTGAAGGCGACAGGGCGGGCTATTGAGAAGGCGCTGAACGTAGCCAAAT
GGTTCGAGGAAAAGGAAACCGAGTACACAGTCTGTGTCAATACGGGGAGCGTGGTTGTCGTGGATGATATCGTCG
AGGACGAAGAAATTAAAGCAAAAGAAGAACAGAAACGGCAACGGCAGCAAGAGCAAACCCCAACTGACCAGGGAG
ATGCGGCTTCTAAGCCGGAATCCAAGTCAGCCGCAAAGAAGAGGAAACGTCAGGCCGCCGCGGTAGAGGATGATG
CCGAGCTCCCCGAGAGCCGGATAAGGTGGATCAAAATGGTTGAAGTCGCCGTCAGCCTTAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail