Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2646.t1
Gene name
Locationscaffold_03:572492..577122
Strand-
Gene length (bp)4630
Transcript length (bp)4440
Coding sequence length (bp)4440
Protein length (aa) 1480

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18404 Glyco_transf_24 Glucosyltransferase 24 7.3E-147 1186 1452
PF18402 Thioredoxin_14 Thioredoxin-like domain 1.9E-62 414 657
PF18400 Thioredoxin_12 Thioredoxin-like domain 2.7E-48 43 225
PF18403 Thioredoxin_15 Thioredoxin-like domain 1.4E-41 673 865
PF06427 UDP-g_GGTase UDP-glucose:Glycoprotein Glucosyltransferase 8.5E-42 1037 1146
PF18401 Thioredoxin_13 Thioredoxin-like domain 6.1E-41 280 408

GO

GO Term Description Terminal node
GO:0006486 protein glycosylation Yes
GO:0003980 UDP-glucose:glycoprotein glucosyltransferase activity Yes
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0035251 UDP-glucosyltransferase activity No
GO:0043413 macromolecule glycosylation No
GO:0006464 cellular protein modification process No
GO:0070085 glycosylation No
GO:0016740 transferase activity No
GO:0071704 organic substance metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0036211 protein modification process No
GO:0003824 catalytic activity No
GO:0046527 glucosyltransferase activity No
GO:0044238 primary metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0016758 transferase activity, transferring hexosyl groups No
GO:0008152 metabolic process No
GO:0016757 transferase activity, transferring glycosyl groups No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0044267 cellular protein metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0008194 UDP-glycosyltransferase activity No
GO:0043412 macromolecule modification No
GO:0019538 protein metabolic process No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2646.t1
MRVPTGSHIPWQWYAVVGALLPGWVANASPAVNVALQASFDSAPYLVELLESAAEENSTAYFPLLDRIADGTFED
LTTEKELYDRFLTVVKDDGHIRTPEGLSSFKLSLSVRSSAPRIEAHFQFYNTSVQQSLMVAQDAVCPVWVHSEGK
QYCSSTMERAQQDVVGELDPRELPFDRVLGDASLPPAVLYADITSPMFRDFHETLSDMAKQGQVSYRVRYRPPQH
WISRPLFVSGYGVELALKRTDYIVIDDRDAEQLEEKGAQSLPTDPDETKEDAPGDLRPLSSSDVTRLGLNSAGYV
MDSADPLGTLIKMSQNFPKYSSIVAAHNSTGEMAQEIRHNRLKMLPGGYNAMWINGVQMDKQQIDAFSLIEHLRR
ERKLIEKFRGLGLSADDVVKLLSHRLLTEAQASGEEQRYDYRDNLEGNQVIIWMNNLEKDSRYESWRGDIEGYIA
GSYPGQLPPVSRDLHNVVVSMDSSNPEHMMLVAGNLHAFINRGIPVRFGLVPTISSPESIAQLKVAHYLSDAYGI
ESLVQYFQEYAAKGKMGFPDKSCFQSATRERDLVDEHEALSLDQVLKSEKYDAVVSQTGAYQRRLSLTGDAPQFL
VNGIPVSREGNWMQGMSVQISKDLKLIQQGIVQGIFEEDTWLPEFFLADAFAKRNTFLMPEDPKSVQIVDIANIL
ASDEDALSKTRVLSDKGALESTHMIVVGDFESEAGVKLLTDALNLRNENSDVEILMLHNAASDAEDDAPKNLATL
YISLAKEETIDQVLAKIASGNLETEVQDISTIQTLHQILAKELGFNPGTEGLVVNGRAVGPIEKEHPLSVGEMSQ
LIAYERVKRLDSVAAAVEELGFADKISNPLDFAKLTSLVALSTISDVPEGIFENTPDFRMDVSGKWRTEHSVITI
SNSDDPTIHVGVSLDPASEVAQRWSPILKVLSELSGVQLKIFLNPKEELTELPVKRFYRYVLESEPSFTDKGALA
RPQASFTGVPVEALLTLSMDVPSSWLVAPSESVYDLDNIKLSSVKSGTDVDAVYALEHILIEGHSRDLTTKTPPR
GVQLILGTENNPYFADTIIMANLGYFQFKAQPGLWQINLKPGRSEKIFKIDSVGGLGYNPQSGDENNEVALLSFH
GRTLFPRLSRKPGHEEDDVLETGVQLGSKMDYFAKGLNFASDVLSSVGVGSKSGGEQHADINIFSVASGHLYERM
LNIMMVSVMRHTKHTVKFWFIEQFLSPSFRAFLPSLAREYGFSYEMVTYKWPHWLRAQKEKQREIWGYKILFLDV
LFPLSLDKVIFVDADQIVRTDMYELVTHDLQEAPYGFTPMGDSRTEMEGFRFWKQGYWSTFLRGKPYHISALYVV
DLNRFRALAAGDRLRGQYQMLSSDPNSLSNLDQDLPNHMQHHIPIHSLPQEWLWCETWCSDEDLGVAKTIDLCNN
PLTKEPKLERARRQVPEWTVYDDEIAALASRVAGEQAAAGVEFVQTGEDRKDEL*
Coding >Pro_DTO377G3_2|g2646.t1
ATGAGGGTTCCTACGGGATCTCACATTCCCTGGCAGTGGTATGCCGTCGTCGGAGCTCTGCTACCAGGCTGGGTT
GCCAATGCTAGTCCAGCCGTGAACGTGGCGCTCCAAGCCTCCTTTGACTCGGCCCCATACCTCGTCGAGCTCCTG
GAGTCTGCTGCAGAAGAAAACTCCACCGCCTATTTTCCTTTGTTGGATCGCATCGCCGATGGGACGTTTGAGGAC
CTCACAACTGAGAAGGAGCTCTACGACCGCTTCTTGACAGTTGTGAAGGATGACGGCCATATTCGGACTCCGGAG
GGTCTTTCCTCGTTCAAATTATCGCTTTCGGTCCGATCATCGGCGCCTCGTATTGAGGCGCACTTCCAGTTCTAT
AACACCTCAGTTCAGCAGTCCTTGATGGTGGCTCAAGATGCGGTGTGTCCCGTGTGGGTTCACTCGGAAGGAAAG
CAGTATTGCTCTTCTACCATGGAGCGCGCACAGCAGGACGTTGTCGGAGAATTGGATCCTAGAGAGCTACCGTTT
GATCGTGTCCTAGGCGATGCATCGCTCCCTCCGGCCGTTCTGTACGCAGATATCACCTCTCCGATGTTCAGAGAT
TTTCATGAAACCCTGAGCGACATGGCAAAACAGGGACAAGTCTCGTACCGTGTACGCTATAGACCTCCCCAACAC
TGGATTTCTCGTCCCTTGTTTGTGTCTGGATACGGCGTGGAGCTTGCTTTGAAGCGAACGGACTACATTGTTATT
GATGACCGTGATGCAGAGCAGCTCGAAGAAAAGGGCGCCCAAAGTCTTCCAACTGACCCGGATGAGACCAAGGAA
GATGCTCCAGGTGACCTCCGGCCTCTGTCTTCCTCCGATGTGACCCGTCTAGGCTTGAACTCTGCGGGCTACGTT
ATGGACAGCGCTGATCCTTTGGGAACATTGATCAAGATGTCCCAAAATTTCCCCAAGTATTCATCGATAGTAGCT
GCCCACAATTCCACTGGGGAAATGGCACAAGAGATCCGCCACAACCGGTTAAAAATGCTTCCTGGTGGTTACAAT
GCCATGTGGATCAACGGTGTGCAGATGGACAAACAACAGATTGACGCATTCTCACTTATTGAACATCTTCGCCGA
GAGAGGAAATTGATTGAGAAATTCCGCGGCCTCGGTCTCTCTGCGGATGATGTCGTGAAGTTACTGTCACATCGA
CTCCTCACTGAAGCTCAAGCTAGTGGCGAGGAGCAACGGTATGACTACCGGGATAATTTAGAAGGGAACCAGGTT
ATCATTTGGATGAACAATCTGGAAAAGGACTCGAGATATGAGTCCTGGCGTGGTGATATCGAGGGGTACATCGCC
GGCTCTTACCCGGGACAATTGCCTCCGGTGAGCCGGGATCTGCACAATGTCGTTGTTTCTATGGACTCGTCTAAT
CCAGAACACATGATGCTTGTTGCTGGAAACTTGCACGCCTTCATCAACCGAGGAATCCCTGTGAGATTCGGCTTG
GTACCTACCATCTCGTCGCCAGAGTCCATTGCGCAGCTGAAGGTAGCGCATTACCTTTCTGATGCATATGGCATA
GAGTCTCTTGTGCAATATTTCCAAGAGTATGCCGCGAAAGGCAAAATGGGCTTCCCAGACAAATCATGCTTCCAG
TCTGCGACTAGAGAACGCGACCTGGTTGACGAACACGAAGCTCTGTCTCTTGATCAAGTCTTGAAGAGTGAAAAG
TATGACGCTGTGGTGTCCCAAACTGGTGCTTACCAGCGTCGGTTGAGTCTGACGGGCGACGCACCTCAATTTCTA
GTGAACGGTATCCCTGTCTCCCGAGAAGGCAACTGGATGCAGGGAATGAGCGTACAGATCAGCAAGGACTTGAAA
TTGATCCAGCAAGGCATTGTTCAGGGAATTTTCGAGGAGGACACATGGCTTCCGGAGTTTTTCCTAGCTGACGCA
TTCGCGAAACGCAATACTTTCCTCATGCCCGAGGATCCCAAGAGTGTACAGATTGTGGACATCGCTAATATTCTT
GCCTCGGATGAAGATGCATTGAGTAAGACTCGTGTTCTCTCAGACAAGGGAGCCCTAGAGAGCACTCATATGATA
GTTGTGGGCGATTTCGAGTCAGAGGCGGGTGTGAAACTACTTACCGATGCTCTTAATCTTCGAAATGAGAACAGT
GACGTGGAGATTCTGATGCTGCACAATGCGGCATCGGACGCCGAGGATGATGCCCCCAAGAATCTCGCTACTCTC
TATATCTCGCTTGCGAAGGAGGAAACTATCGACCAAGTACTGGCTAAGATTGCATCCGGTAATCTCGAGACTGAA
GTCCAAGATATCTCTACCATTCAAACTTTGCACCAAATCCTGGCCAAAGAACTTGGATTCAACCCTGGCACTGAG
GGACTTGTTGTCAATGGGAGAGCAGTCGGCCCTATTGAGAAGGAACATCCGTTGAGTGTGGGAGAGATGAGCCAA
CTGATTGCCTACGAACGGGTGAAACGCCTCGATTCTGTTGCGGCGGCTGTTGAGGAACTCGGATTCGCGGATAAG
ATTTCAAACCCGCTCGATTTCGCTAAATTGACATCGCTTGTGGCTCTTTCCACCATCTCTGATGTCCCTGAGGGC
ATTTTCGAAAATACTCCTGATTTCAGAATGGACGTCTCCGGTAAATGGAGGACGGAGCACTCTGTTATCACCATT
TCCAACTCCGATGATCCCACGATTCACGTTGGTGTTAGCCTTGACCCAGCATCCGAGGTTGCCCAGCGATGGTCG
CCGATTCTGAAGGTACTGTCCGAACTCTCCGGCGTTCAACTGAAGATTTTCTTGAACCCGAAGGAAGAGCTCACG
GAGCTGCCAGTCAAGCGATTCTACCGCTATGTCTTGGAATCAGAGCCATCTTTCACGGATAAGGGGGCTCTGGCT
CGGCCGCAGGCGTCATTCACTGGCGTGCCAGTCGAAGCACTGCTGACTTTGAGCATGGATGTGCCGTCATCTTGG
CTCGTAGCACCCAGTGAATCAGTCTACGACCTGGATAACATTAAGTTGAGCTCGGTCAAGTCTGGTACTGATGTT
GATGCCGTCTACGCTCTCGAGCACATTCTGATCGAGGGCCACTCTCGTGATCTTACAACGAAGACTCCACCTAGA
GGTGTCCAGCTTATCTTGGGCACTGAGAACAACCCCTATTTCGCCGATACTATCATCATGGCCAACCTGGGATAC
TTCCAGTTCAAGGCACAGCCAGGCTTGTGGCAGATCAACTTGAAGCCCGGACGTAGCGAGAAGATCTTCAAGATC
GATAGCGTTGGTGGTCTAGGATACAATCCGCAGAGCGGTGACGAGAACAATGAGGTTGCTCTGCTATCCTTCCAT
GGTCGGACGCTATTCCCTCGACTGTCGCGAAAGCCAGGCCACGAGGAAGACGATGTTCTCGAGACAGGAGTCCAG
CTAGGCTCAAAGATGGACTATTTTGCCAAAGGACTCAACTTTGCATCTGACGTCCTCTCCAGTGTTGGTGTCGGG
TCCAAGAGCGGAGGCGAACAGCACGCCGATATCAACATCTTCTCAGTAGCTAGTGGACACCTCTATGAGCGCATG
TTAAACATCATGATGGTCTCAGTGATGCGACACACCAAACACACCGTCAAATTCTGGTTCATCGAGCAATTCCTC
TCCCCATCCTTCCGCGCCTTCCTCCCTTCTCTCGCCCGCGAATACGGCTTCTCATACGAGATGGTAACATACAAG
TGGCCGCACTGGCTGCGCGCCCAGAAAGAAAAGCAACGCGAGATCTGGGGGTACAAGATTCTCTTCCTGGATGTG
CTCTTTCCCCTCTCCCTGGACAAAGTAATCTTCGTCGACGCGGATCAGATTGTGCGCACCGACATGTACGAACTT
GTCACCCACGACCTCCAAGAAGCGCCCTACGGCTTCACGCCGATGGGTGACTCTCGAACCGAAATGGAAGGCTTC
CGCTTCTGGAAACAAGGATACTGGTCCACCTTCCTCCGAGGCAAGCCTTACCACATCTCGGCGCTGTACGTCGTC
GACTTGAACCGCTTCCGCGCGCTTGCTGCTGGCGACCGTCTGCGCGGCCAATACCAGATGCTCTCGTCGGATCCA
AACAGTCTCAGCAATCTCGACCAGGACCTGCCCAACCACATGCAGCATCACATTCCCATCCATAGTCTGCCGCAG
GAGTGGCTTTGGTGTGAGACTTGGTGTTCGGATGAAGATTTAGGTGTGGCGAAGACTATTGACCTTTGTAACAAT
CCTCTTACTAAGGAGCCTAAGCTAGAGAGGGCTAGGAGGCAGGTTCCTGAATGGACGGTCTATGATGATGAGATT
GCGGCTTTGGCGAGTCGCGTTGCTGGCGAGCAGGCTGCTGCTGGGGTTGAGTTTGTGCAGACTGGCGAGGACCGC
AAAGATGAATTATAG
Transcript >Pro_DTO377G3_2|g2646.t1
ATGAGGGTTCCTACGGGATCTCACATTCCCTGGCAGTGGTATGCCGTCGTCGGAGCTCTGCTACCAGGCTGGGTT
GCCAATGCTAGTCCAGCCGTGAACGTGGCGCTCCAAGCCTCCTTTGACTCGGCCCCATACCTCGTCGAGCTCCTG
GAGTCTGCTGCAGAAGAAAACTCCACCGCCTATTTTCCTTTGTTGGATCGCATCGCCGATGGGACGTTTGAGGAC
CTCACAACTGAGAAGGAGCTCTACGACCGCTTCTTGACAGTTGTGAAGGATGACGGCCATATTCGGACTCCGGAG
GGTCTTTCCTCGTTCAAATTATCGCTTTCGGTCCGATCATCGGCGCCTCGTATTGAGGCGCACTTCCAGTTCTAT
AACACCTCAGTTCAGCAGTCCTTGATGGTGGCTCAAGATGCGGTGTGTCCCGTGTGGGTTCACTCGGAAGGAAAG
CAGTATTGCTCTTCTACCATGGAGCGCGCACAGCAGGACGTTGTCGGAGAATTGGATCCTAGAGAGCTACCGTTT
GATCGTGTCCTAGGCGATGCATCGCTCCCTCCGGCCGTTCTGTACGCAGATATCACCTCTCCGATGTTCAGAGAT
TTTCATGAAACCCTGAGCGACATGGCAAAACAGGGACAAGTCTCGTACCGTGTACGCTATAGACCTCCCCAACAC
TGGATTTCTCGTCCCTTGTTTGTGTCTGGATACGGCGTGGAGCTTGCTTTGAAGCGAACGGACTACATTGTTATT
GATGACCGTGATGCAGAGCAGCTCGAAGAAAAGGGCGCCCAAAGTCTTCCAACTGACCCGGATGAGACCAAGGAA
GATGCTCCAGGTGACCTCCGGCCTCTGTCTTCCTCCGATGTGACCCGTCTAGGCTTGAACTCTGCGGGCTACGTT
ATGGACAGCGCTGATCCTTTGGGAACATTGATCAAGATGTCCCAAAATTTCCCCAAGTATTCATCGATAGTAGCT
GCCCACAATTCCACTGGGGAAATGGCACAAGAGATCCGCCACAACCGGTTAAAAATGCTTCCTGGTGGTTACAAT
GCCATGTGGATCAACGGTGTGCAGATGGACAAACAACAGATTGACGCATTCTCACTTATTGAACATCTTCGCCGA
GAGAGGAAATTGATTGAGAAATTCCGCGGCCTCGGTCTCTCTGCGGATGATGTCGTGAAGTTACTGTCACATCGA
CTCCTCACTGAAGCTCAAGCTAGTGGCGAGGAGCAACGGTATGACTACCGGGATAATTTAGAAGGGAACCAGGTT
ATCATTTGGATGAACAATCTGGAAAAGGACTCGAGATATGAGTCCTGGCGTGGTGATATCGAGGGGTACATCGCC
GGCTCTTACCCGGGACAATTGCCTCCGGTGAGCCGGGATCTGCACAATGTCGTTGTTTCTATGGACTCGTCTAAT
CCAGAACACATGATGCTTGTTGCTGGAAACTTGCACGCCTTCATCAACCGAGGAATCCCTGTGAGATTCGGCTTG
GTACCTACCATCTCGTCGCCAGAGTCCATTGCGCAGCTGAAGGTAGCGCATTACCTTTCTGATGCATATGGCATA
GAGTCTCTTGTGCAATATTTCCAAGAGTATGCCGCGAAAGGCAAAATGGGCTTCCCAGACAAATCATGCTTCCAG
TCTGCGACTAGAGAACGCGACCTGGTTGACGAACACGAAGCTCTGTCTCTTGATCAAGTCTTGAAGAGTGAAAAG
TATGACGCTGTGGTGTCCCAAACTGGTGCTTACCAGCGTCGGTTGAGTCTGACGGGCGACGCACCTCAATTTCTA
GTGAACGGTATCCCTGTCTCCCGAGAAGGCAACTGGATGCAGGGAATGAGCGTACAGATCAGCAAGGACTTGAAA
TTGATCCAGCAAGGCATTGTTCAGGGAATTTTCGAGGAGGACACATGGCTTCCGGAGTTTTTCCTAGCTGACGCA
TTCGCGAAACGCAATACTTTCCTCATGCCCGAGGATCCCAAGAGTGTACAGATTGTGGACATCGCTAATATTCTT
GCCTCGGATGAAGATGCATTGAGTAAGACTCGTGTTCTCTCAGACAAGGGAGCCCTAGAGAGCACTCATATGATA
GTTGTGGGCGATTTCGAGTCAGAGGCGGGTGTGAAACTACTTACCGATGCTCTTAATCTTCGAAATGAGAACAGT
GACGTGGAGATTCTGATGCTGCACAATGCGGCATCGGACGCCGAGGATGATGCCCCCAAGAATCTCGCTACTCTC
TATATCTCGCTTGCGAAGGAGGAAACTATCGACCAAGTACTGGCTAAGATTGCATCCGGTAATCTCGAGACTGAA
GTCCAAGATATCTCTACCATTCAAACTTTGCACCAAATCCTGGCCAAAGAACTTGGATTCAACCCTGGCACTGAG
GGACTTGTTGTCAATGGGAGAGCAGTCGGCCCTATTGAGAAGGAACATCCGTTGAGTGTGGGAGAGATGAGCCAA
CTGATTGCCTACGAACGGGTGAAACGCCTCGATTCTGTTGCGGCGGCTGTTGAGGAACTCGGATTCGCGGATAAG
ATTTCAAACCCGCTCGATTTCGCTAAATTGACATCGCTTGTGGCTCTTTCCACCATCTCTGATGTCCCTGAGGGC
ATTTTCGAAAATACTCCTGATTTCAGAATGGACGTCTCCGGTAAATGGAGGACGGAGCACTCTGTTATCACCATT
TCCAACTCCGATGATCCCACGATTCACGTTGGTGTTAGCCTTGACCCAGCATCCGAGGTTGCCCAGCGATGGTCG
CCGATTCTGAAGGTACTGTCCGAACTCTCCGGCGTTCAACTGAAGATTTTCTTGAACCCGAAGGAAGAGCTCACG
GAGCTGCCAGTCAAGCGATTCTACCGCTATGTCTTGGAATCAGAGCCATCTTTCACGGATAAGGGGGCTCTGGCT
CGGCCGCAGGCGTCATTCACTGGCGTGCCAGTCGAAGCACTGCTGACTTTGAGCATGGATGTGCCGTCATCTTGG
CTCGTAGCACCCAGTGAATCAGTCTACGACCTGGATAACATTAAGTTGAGCTCGGTCAAGTCTGGTACTGATGTT
GATGCCGTCTACGCTCTCGAGCACATTCTGATCGAGGGCCACTCTCGTGATCTTACAACGAAGACTCCACCTAGA
GGTGTCCAGCTTATCTTGGGCACTGAGAACAACCCCTATTTCGCCGATACTATCATCATGGCCAACCTGGGATAC
TTCCAGTTCAAGGCACAGCCAGGCTTGTGGCAGATCAACTTGAAGCCCGGACGTAGCGAGAAGATCTTCAAGATC
GATAGCGTTGGTGGTCTAGGATACAATCCGCAGAGCGGTGACGAGAACAATGAGGTTGCTCTGCTATCCTTCCAT
GGTCGGACGCTATTCCCTCGACTGTCGCGAAAGCCAGGCCACGAGGAAGACGATGTTCTCGAGACAGGAGTCCAG
CTAGGCTCAAAGATGGACTATTTTGCCAAAGGACTCAACTTTGCATCTGACGTCCTCTCCAGTGTTGGTGTCGGG
TCCAAGAGCGGAGGCGAACAGCACGCCGATATCAACATCTTCTCAGTAGCTAGTGGACACCTCTATGAGCGCATG
TTAAACATCATGATGGTCTCAGTGATGCGACACACCAAACACACCGTCAAATTCTGGTTCATCGAGCAATTCCTC
TCCCCATCCTTCCGCGCCTTCCTCCCTTCTCTCGCCCGCGAATACGGCTTCTCATACGAGATGGTAACATACAAG
TGGCCGCACTGGCTGCGCGCCCAGAAAGAAAAGCAACGCGAGATCTGGGGGTACAAGATTCTCTTCCTGGATGTG
CTCTTTCCCCTCTCCCTGGACAAAGTAATCTTCGTCGACGCGGATCAGATTGTGCGCACCGACATGTACGAACTT
GTCACCCACGACCTCCAAGAAGCGCCCTACGGCTTCACGCCGATGGGTGACTCTCGAACCGAAATGGAAGGCTTC
CGCTTCTGGAAACAAGGATACTGGTCCACCTTCCTCCGAGGCAAGCCTTACCACATCTCGGCGCTGTACGTCGTC
GACTTGAACCGCTTCCGCGCGCTTGCTGCTGGCGACCGTCTGCGCGGCCAATACCAGATGCTCTCGTCGGATCCA
AACAGTCTCAGCAATCTCGACCAGGACCTGCCCAACCACATGCAGCATCACATTCCCATCCATAGTCTGCCGCAG
GAGTGGCTTTGGTGTGAGACTTGGTGTTCGGATGAAGATTTAGGTGTGGCGAAGACTATTGACCTTTGTAACAAT
CCTCTTACTAAGGAGCCTAAGCTAGAGAGGGCTAGGAGGCAGGTTCCTGAATGGACGGTCTATGATGATGAGATT
GCGGCTTTGGCGAGTCGCGTTGCTGGCGAGCAGGCTGCTGCTGGGGTTGAGTTTGTGCAGACTGGCGAGGACCGC
AAAGATGAATTATAG
Gene >Pro_DTO377G3_2|g2646.t1
ATGAGGGTTCCTACGGGATCTCACATTCCCTGGCAGTGGTATGCCGTCGTCGGAGCTCTGCTACCAGGCTGGGTT
GCCAATGCTAGTCCAGCCGTGAACGTGGCGCTCCAAGCCTCCTTTGACTCGGCCCCATACCTCGTCGAGCTCCTG
TACGTTGCACATTGAGTGATCTCTCGCCTGGGATATATATGTCAATATGATGGCTAATTAATTCAATGTAGGGAG
TCTGCTGCAGAAGAAAACTCCACCGCCTATTTTCCTTTGTTGGATCGCATCGCCGATGGGACGTTTGAGGACCTC
ACAACTGAGAAGGAGCTCTACGACCGCTTCTTGACAGTTGTGAAGGATGACGGCCATATTCGGACTCCGGAGGGT
CTTTCCTCGTTCAAATTATCGCTTTCGGTCCGATCATCGGCGCCTCGTATTGAGGCGCACTTCCAGTTCTATAAC
ACCTCAGTTCAGCAGTCCTTGATGGTGGCTCAAGATGCGGTGTGTCCCGTGTGGGTTCACTCGGAAGGAAAGCAG
TATTGCTCTTCTACCATGGAGCGCGCACAGCAGGACGTTGTCGGAGAATTGTGGGTAGAGCTTTGTTCGTGTCGC
ATGGACTCTAATAGCTGACATTGAATTTGTGCCTTTAGGGATCCTAGAGAGCTACCGTTTGATCGTGTCCTAGGC
GATGCATCGCTCCCTCCGGCCGTTCTGTACGCAGATATCACCTCTCCGATGTTCAGAGATTTTCATGAAACCCTG
AGCGACATGGCAAAACAGGGACAAGTCTCGTACCGTGTACGCTATAGACCTCCCCAACACTGGATTTCTCGTCCC
TTGTTTGTGTCTGGATACGGCGTGGAGCTTGCTTTGAAGCGAACGGACTACATTGTTATTGATGACCGTGATGCA
GAGCAGCTCGAAGAAAAGGGCGCCCAAAGTCTTCCAACTGACCCGGATGAGACCAAGGAAGATGCTCCAGGTGAC
CTCCGGCCTCTGTCTTCCTCCGATGTGACCCGTCTAGGCTTGAACTCTGCGGGCTACGTTATGGACAGCGCTGAT
CCTTTGGGAACATTGATCAAGATGTCCCAAAATTTCCCCAAGTATTCATCGATAGTAGCTGCCCACAATTCCACT
GGGGAAATGGCACAAGAGATCCGCCACAACCGGTTAAAAATGCTTCCTGGTGGTTACAATGCCATGTGGATCAAC
GGTGTGCAGATGGACAAACAACAGATTGACGCATTCTCACTTATTGAACATCTTCGCCGAGAGAGGAAATTGATT
GAGAAATTCCGCGGCCTCGGTCTCTCTGCGGATGATGTCGTGAAGTTACTGTCACATCGACTCCTCACTGAAGCT
CAAGCTAGTGGCGAGGAGCAACGGTATGACTACCGGGATAATTTAGAAGGGAACCAGGTTATCATTTGGATGAAC
AATCTGGAAAAGGACTCGAGATATGAGTCCTGGCGTGGTGATATCGAGGGGGTTCGTACTTATTTCGTATGGCTA
TTGGACGGAATTCATATTAACATAATTCTAGTACATCGCCGGCTCTTACCCGGGACAATTGCCTCCGGTGAGCCG
GGATCTGCACAATGTCGTTGTTTCTATGGACTCGTCTAATCCAGAACACATGATGCTTGTTGCTGGAAACTTGCA
CGCCTTCATCAACCGAGGAATCCCTGTGAGATTCGGCTTGGTACCTACCATCTCGTCGCCAGAGTCCATTGCGCA
GCTGAAGGTAGCGCATTACCTTTCTGATGCATATGGCATAGAGTCTCTTGTGCAATATTTCCAAGAGTATGCCGC
GAAAGGCAAAATGGGCTTCCCAGACAAATCATGCTTCCAGTCTGCGACTAGAGAACGCGACCTGGTTGACGAACA
CGAAGCTCTGTCTCTTGATCAAGTCTTGAAGAGTGAAAAGTATGACGCTGTGGTGTCCCAAACTGGTGCTTACCA
GCGTCGGTTGAGTCTGACGGGCGACGCACCTCAATTTCTAGTGAACGGTATCCCTGTCTCCCGAGAAGGCAACTG
GATGCAGGGAATGAGCGTACAGATCAGCAAGGACTTGAAATTGATCCAGCAAGGCATTGTTCAGGGAATTTTCGA
GGAGGACACATGGCTTCCGGAGTTTTTCCTAGCTGACGCATTCGCGAAACGCAATACTTTCCTCATGCCCGAGGA
TCCCAAGAGTGTACAGATTGTGGACATCGCTAATATTCTTGCCTCGGATGAAGATGCATTGAGTAAGACTCGTGT
TCTCTCAGACAAGGGAGCCCTAGAGAGCACTCATATGATAGTTGTGGGCGATTTCGAGTCAGAGGCGGGTGTGAA
ACTACTTACCGATGCTCTTAATCTTCGAAATGAGAACAGTGACGTGGAGATTCTGATGCTGCACAATGCGGCATC
GGACGCCGAGGATGATGCCCCCAAGAATCTCGCTACTCTCTATATCTCGCTTGCGAAGGAGGAAACTATCGACCA
AGTACTGGCTAAGATTGCATCCGGTAATCTCGAGACTGAAGTCCAAGATATCTCTACCATTCAAACTTTGCACCA
AATCCTGGCCAAAGAACTTGGATTCAACCCTGGCACTGAGGGACTTGTTGTCAATGGGAGAGCAGTCGGCCCTAT
TGAGAAGGAACATCCGTTGAGTGTGGGAGAGATGAGCCAACTGATTGCCTACGAACGGGTGAAACGCCTCGATTC
TGTTGCGGCGGCTGTTGAGGAACTCGGATTCGCGGATAAGATTTCAAACCCGCTCGATTTCGCTAAATTGACATC
GCTTGTGGCTCTTTCCACCATCTCTGATGTCCCTGAGGGCATTTTCGAAAATACTCCTGATTTCAGAATGGACGT
CTCCGGTAAATGGAGGACGGAGCACTCTGTTATCACCATTTCCAACTCCGATGATCCCACGATTCACGTTGGTGT
TAGCCTTGACCCAGCATCCGAGGTTGCCCAGCGATGGTCGCCGATTCTGAAGGTACTGTCCGAACTCTCCGGCGT
TCAACTGAAGATTTTCTTGAACCCGAAGGAAGAGCTCACGGAGCTGCCAGTCAAGCGATTCTACCGCTATGTCTT
GGAATCAGAGCCATCTTTCACGGATAAGGGGGCTCTGGCTCGGCCGCAGGCGTCATTCACTGGCGTGCCAGTCGA
AGCACTGCTGACTTTGAGCATGGATGTGCCGTCATCTTGGCTCGTAGCACCCAGTGAATCAGTCTACGACCTGGA
TAACATTAAGTTGAGCTCGGTCAAGTCTGGTACTGATGTTGATGCCGTCTACGCTCTCGAGCACATTCTGATCGA
GGGCCACTCTCGTGATCTTACAACGAAGACTCCACCTAGAGGTGTCCAGCTTATCTTGGGCACTGAGAACAACCC
CTATTTCGCCGATACTATCATCATGGCCAACCTGGGATACTTCCAGTTCAAGGCACAGCCAGGCTTGTGGCAGAT
CAACTTGAAGCCCGGACGTAGCGAGAAGATCTTCAAGATCGATAGCGTTGGTGGTCTAGGATACAATCCGCAGAG
CGGTGACGAGAACAATGAGGTTGCTCTGCTATCCTTCCATGGTCGGACGCTATTCCCTCGACTGTCGCGAAAGCC
AGGCCACGAGGAAGACGATGTTCTCGAGACAGGAGTCCAGCTAGGCTCAAAGATGGACTATTTTGCCAAAGGACT
CAACTTTGCATCTGACGTCCTCTCCAGTGTTGGTGTCGGGTCCAAGAGCGGAGGCGAACAGCACGCCGATATCAA
CATCTTCTCAGTAGCTAGTGGACACCTCTATGAGCGCATGTTAAACATCATGATGGTCTCAGTGATGCGACACAC
CAAACACACCGTCAAATTCTGGTTCATCGAGCAATTCCTCTCCCCATCCTTCCGCGCCTTCCTCCCTTCTCTCGC
CCGCGAATACGGCTTCTCATACGAGATGGTAACATACAAGTGGCCGCACTGGCTGCGCGCCCAGAAAGAAAAGCA
ACGCGAGATCTGGGGGTACAAGATTCTCTTCCTGGATGTGCTCTTTCCCCTCTCCCTGGACAAAGTAATCTTCGT
CGACGCGGATCAGATTGTGCGCACCGACATGTACGAACTTGTCACCCACGACCTCCAAGAAGCGCCCTACGGCTT
CACGCCGATGGGTGACTCTCGAACCGAAATGGAAGGCTTCCGCTTCTGGAAACAAGGATACTGGTCCACCTTCCT
CCGAGGCAAGCCTTACCACATCTCGGCGCTGTACGTCGTCGACTTGAACCGCTTCCGCGCGCTTGCTGCTGGCGA
CCGTCTGCGCGGCCAATACCAGATGCTCTCGTCGGATCCAAACAGTCTCAGCAATCTCGACCAGGACCTGCCCAA
CCACATGCAGCATCACATTCCCATCCATAGTCTGCCGCAGGAGTGGCTTTGGTGTGAGACTTGGTGTTCGGATGA
AGATTTAGGTGTGGCGAAGACTATTGACCTTTGTAACAATCCTCTTACTAAGGAGCCTAAGCTAGAGAGGGCTAG
GAGGCAGGTTCCTGAATGGACGGTCTATGATGATGAGATTGCGGCTTTGGCGAGTCGCGTTGCTGGCGAGCAGGC
TGCTGCTGGGGTTGAGTTTGTGCAGACTGGCGAGGACCGCAAAGATGAATTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail