Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2645.t1
Gene name
Locationscaffold_03:570124..572284
Strand+
Gene length (bp)2160
Transcript length (bp)2103
Coding sequence length (bp)2103
Protein length (aa) 701

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 3.8E-08 300 340
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 5.1E-08 351 417
PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain 7.8E-12 301 359

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 17.49 9.43 25.56
5d_25C Five days - 25 degrees Celsius 12.32 6.12 18.53
7d_25C Seven days - 25 degrees Celsius 10.34 4.84 15.84
10d_25C Ten days - 25 degrees Celsius 5.95 2.40 9.50
7d_15C Seven days - 15 degrees Celsius 13.11 6.65 19.57
7d_30C Seven days - 30 degrees Celsius 11.62 5.66 17.58

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.214612 no
3d_25C 7d_25C 0.046159 yes
3d_25C 7d_15C 0.311874 no
3d_25C 7d_30C 0.146998 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.615148 no
5d_25C 7d_15C 0.879436 no
5d_25C 7d_30C 0.890983 no
5d_25C 10d_25C 0.010735 yes
7d_25C 7d_15C 0.455884 no
7d_25C 7d_30C 0.766977 no
7d_25C 10d_25C 0.065131 no
7d_15C 7d_30C 0.746641 no
7d_15C 10d_25C 0.004045 yes
7d_30C 10d_25C 0.022165 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2645.t1
MGNTSSQLEPYPEIADDFGDIVPETPNPPKVGGTKKNNKEHISSETEALSPVIGKAYGTERLSELDSNMSNPSKR
KRDSEPERKKKIKKPRKSEKSVAESPSPERSSTRFEIAIHNAPTPSQPTTSKPKSSSKKVRKQNGKNLNILTSST
AQPTLESTVAEGPSAVKQLAATKRTPAPDSPNTEDSNTPGGKTKGVRSSRIRERDNLKIGFYTPDEVRKIEAYKV
NVCTMHGIPSAKFDEMVQHSERTRELSVESPFFSYGILKGDFWDEIYALLPDRDRRSVYRFMRRHFQASAQRAHE
WSKEQDDELIELHAQHGPKWTFIGKLIGRSDDDVTQRWKNKLEHQNTMNQGAWSEEEHKMFLDAVESTWVTMKPM
LPDKAGKDMYELDERLIVWGNISKEIGYVRSRQQCADKWRKIVKQVMVLRANGQPDAVFDPKLAAKKSAHWNMRL
ETQRKSSQFVNEDTDDDEDMITTTPSSKPHDEAAPSSIVNANAESDHEAQSKEGEPNLPAPLKNDMKSKFKRKHN
EDSASGPIEKAPSSPGAPQKSKEERKREKKERKERKREKKEQREKKRQEKEKGEQIEQEVPEDKAARKEQKWKRR
EEKKKRKILEEERLAAEEANQASGSNESPKEKKKSKKQKQASIGSPTSLVKPSHSVVEAFPLPTSPVSHGADAVD
DEYDSDGGDEDSEVYFKYESDSEEL*
Coding >Pro_DTO377G3_2|g2645.t1
ATGGGAAATACATCTTCTCAGCTCGAACCATACCCTGAAATTGCTGACGATTTTGGAGATATCGTCCCTGAAACT
CCCAATCCCCCCAAGGTTGGCGGGACGAAGAAAAATAATAAGGAACACATATCATCAGAAACCGAAGCATTATCT
CCAGTGATTGGGAAAGCCTATGGTACAGAGCGCCTCTCAGAATTAGACTCGAACATGTCGAATCCTTCAAAGCGA
AAGCGCGACTCTGAACCTGAGCGCAAAAAAAAGATCAAGAAGCCTCGCAAATCAGAAAAGTCCGTTGCCGAGTCA
CCTTCACCAGAAAGAAGCTCAACCCGCTTTGAAATTGCTATTCACAATGCCCCCACTCCCAGCCAACCCACTACA
TCAAAGCCTAAGTCTTCGTCAAAGAAGGTTCGCAAGCAGAATGGCAAAAACTTGAATATCCTCACTTCATCCACT
GCTCAACCTACTCTCGAATCAACGGTTGCAGAAGGACCGTCCGCTGTAAAGCAGCTGGCTGCCACCAAGCGAACT
CCAGCCCCTGACTCGCCCAACACTGAGGATAGCAACACGCCAGGAGGCAAGACCAAGGGAGTTAGAAGCTCGCGC
ATTAGGGAGAGGGACAATTTGAAAATTGGCTTCTATACGCCGGATGAAGTGCGAAAAATCGAAGCGTACAAAGTC
AATGTCTGTACCATGCATGGCATTCCTAGTGCCAAATTCGACGAGATGGTTCAGCATTCTGAGCGTACCCGTGAA
TTAAGCGTCGAATCTCCATTCTTCTCATATGGCATCCTCAAAGGCGACTTTTGGGACGAGATCTACGCTCTTCTT
CCGGATCGTGATCGGCGATCTGTATACCGATTCATGCGTCGACACTTCCAAGCTTCGGCTCAAAGGGCACACGAA
TGGTCGAAGGAACAAGATGATGAGCTTATCGAGCTCCACGCCCAACACGGTCCGAAATGGACTTTCATTGGTAAG
CTCATTGGGCGCAGTGATGACGATGTCACTCAGCGCTGGAAGAACAAGCTCGAGCACCAGAACACCATGAACCAA
GGTGCGTGGTCGGAGGAAGAACACAAGATGTTCCTTGACGCCGTGGAATCAACGTGGGTCACCATGAAGCCAATG
CTTCCCGATAAGGCAGGCAAGGACATGTACGAGCTGGATGAGCGCCTCATTGTATGGGGTAACATTAGCAAGGAG
ATTGGTTATGTGCGGTCTCGACAACAATGTGCAGACAAATGGCGCAAGATCGTGAAACAGGTCATGGTCCTGCGG
GCCAATGGCCAGCCAGACGCGGTGTTCGATCCCAAACTCGCTGCTAAGAAAAGTGCCCACTGGAACATGAGATTG
GAGACGCAAAGGAAGAGCTCTCAATTCGTGAACGAGGATACTGATGACGACGAGGACATGATAACTACCACCCCG
AGCTCAAAGCCCCATGATGAGGCAGCACCATCTTCCATTGTCAATGCCAATGCCGAGTCTGACCACGAAGCGCAG
TCTAAAGAGGGTGAGCCCAACTTGCCCGCACCTCTCAAAAATGATATGAAGTCAAAATTTAAGCGCAAGCACAAT
GAAGATTCCGCGTCCGGTCCCATCGAGAAAGCCCCGTCATCTCCCGGCGCCCCCCAAAAGAGCAAGGAGGAGAGG
AAGCGCGAGAAGAAGGAGAGGAAGGAGAGGAAACGCGAGAAGAAGGAGCAACGAGAGAAGAAGAGGCAAGAGAAA
GAAAAGGGAGAGCAGATTGAGCAAGAAGTCCCGGAAGACAAGGCCGCACGCAAAGAGCAAAAGTGGAAGAGGAGG
GAGGAGAAGAAGAAGCGAAAGATATTAGAAGAGGAACGTCTCGCTGCCGAGGAGGCTAACCAGGCATCTGGCAGT
AATGAATCCCCTAAGGAGAAGAAAAAGTCCAAGAAGCAGAAACAAGCTTCCATTGGCAGCCCTACCTCTTTGGTC
AAGCCCTCTCATTCTGTTGTCGAAGCATTCCCATTGCCCACATCACCTGTTTCTCACGGTGCTGATGCTGTCGAT
GATGAATATGACTCAGACGGCGGAGATGAGGACAGCGAAGTTTACTTCAAGTACGAGAGTGACTCGGAAGAGCTG
TGA
Transcript >Pro_DTO377G3_2|g2645.t1
ATGGGAAATACATCTTCTCAGCTCGAACCATACCCTGAAATTGCTGACGATTTTGGAGATATCGTCCCTGAAACT
CCCAATCCCCCCAAGGTTGGCGGGACGAAGAAAAATAATAAGGAACACATATCATCAGAAACCGAAGCATTATCT
CCAGTGATTGGGAAAGCCTATGGTACAGAGCGCCTCTCAGAATTAGACTCGAACATGTCGAATCCTTCAAAGCGA
AAGCGCGACTCTGAACCTGAGCGCAAAAAAAAGATCAAGAAGCCTCGCAAATCAGAAAAGTCCGTTGCCGAGTCA
CCTTCACCAGAAAGAAGCTCAACCCGCTTTGAAATTGCTATTCACAATGCCCCCACTCCCAGCCAACCCACTACA
TCAAAGCCTAAGTCTTCGTCAAAGAAGGTTCGCAAGCAGAATGGCAAAAACTTGAATATCCTCACTTCATCCACT
GCTCAACCTACTCTCGAATCAACGGTTGCAGAAGGACCGTCCGCTGTAAAGCAGCTGGCTGCCACCAAGCGAACT
CCAGCCCCTGACTCGCCCAACACTGAGGATAGCAACACGCCAGGAGGCAAGACCAAGGGAGTTAGAAGCTCGCGC
ATTAGGGAGAGGGACAATTTGAAAATTGGCTTCTATACGCCGGATGAAGTGCGAAAAATCGAAGCGTACAAAGTC
AATGTCTGTACCATGCATGGCATTCCTAGTGCCAAATTCGACGAGATGGTTCAGCATTCTGAGCGTACCCGTGAA
TTAAGCGTCGAATCTCCATTCTTCTCATATGGCATCCTCAAAGGCGACTTTTGGGACGAGATCTACGCTCTTCTT
CCGGATCGTGATCGGCGATCTGTATACCGATTCATGCGTCGACACTTCCAAGCTTCGGCTCAAAGGGCACACGAA
TGGTCGAAGGAACAAGATGATGAGCTTATCGAGCTCCACGCCCAACACGGTCCGAAATGGACTTTCATTGGTAAG
CTCATTGGGCGCAGTGATGACGATGTCACTCAGCGCTGGAAGAACAAGCTCGAGCACCAGAACACCATGAACCAA
GGTGCGTGGTCGGAGGAAGAACACAAGATGTTCCTTGACGCCGTGGAATCAACGTGGGTCACCATGAAGCCAATG
CTTCCCGATAAGGCAGGCAAGGACATGTACGAGCTGGATGAGCGCCTCATTGTATGGGGTAACATTAGCAAGGAG
ATTGGTTATGTGCGGTCTCGACAACAATGTGCAGACAAATGGCGCAAGATCGTGAAACAGGTCATGGTCCTGCGG
GCCAATGGCCAGCCAGACGCGGTGTTCGATCCCAAACTCGCTGCTAAGAAAAGTGCCCACTGGAACATGAGATTG
GAGACGCAAAGGAAGAGCTCTCAATTCGTGAACGAGGATACTGATGACGACGAGGACATGATAACTACCACCCCG
AGCTCAAAGCCCCATGATGAGGCAGCACCATCTTCCATTGTCAATGCCAATGCCGAGTCTGACCACGAAGCGCAG
TCTAAAGAGGGTGAGCCCAACTTGCCCGCACCTCTCAAAAATGATATGAAGTCAAAATTTAAGCGCAAGCACAAT
GAAGATTCCGCGTCCGGTCCCATCGAGAAAGCCCCGTCATCTCCCGGCGCCCCCCAAAAGAGCAAGGAGGAGAGG
AAGCGCGAGAAGAAGGAGAGGAAGGAGAGGAAACGCGAGAAGAAGGAGCAACGAGAGAAGAAGAGGCAAGAGAAA
GAAAAGGGAGAGCAGATTGAGCAAGAAGTCCCGGAAGACAAGGCCGCACGCAAAGAGCAAAAGTGGAAGAGGAGG
GAGGAGAAGAAGAAGCGAAAGATATTAGAAGAGGAACGTCTCGCTGCCGAGGAGGCTAACCAGGCATCTGGCAGT
AATGAATCCCCTAAGGAGAAGAAAAAGTCCAAGAAGCAGAAACAAGCTTCCATTGGCAGCCCTACCTCTTTGGTC
AAGCCCTCTCATTCTGTTGTCGAAGCATTCCCATTGCCCACATCACCTGTTTCTCACGGTGCTGATGCTGTCGAT
GATGAATATGACTCAGACGGCGGAGATGAGGACAGCGAAGTTTACTTCAAGTACGAGAGTGACTCGGAAGAGCTG
TGA
Gene >Pro_DTO377G3_2|g2645.t1
ATGGGAAATACATCTTCTCAGCTCGAACCATACCCTGAAATTGCTGACGATTTTGGAGATATCGGTTGGTGAAAT
CACTTGATCTTCACGCGACTCGGTACTAAAATTTGCAATCTGACAGTCCCTGAAACTCCCAATCCCCCCAAGGTT
GGCGGGACGAAGAAAAATAATAAGGAACACATATCATCAGAAACCGAAGCATTATCTCCAGTGATTGGGAAAGCC
TATGGTACAGAGCGCCTCTCAGAATTAGACTCGAACATGTCGAATCCTTCAAAGCGAAAGCGCGACTCTGAACCT
GAGCGCAAAAAAAAGATCAAGAAGCCTCGCAAATCAGAAAAGTCCGTTGCCGAGTCACCTTCACCAGAAAGAAGC
TCAACCCGCTTTGAAATTGCTATTCACAATGCCCCCACTCCCAGCCAACCCACTACATCAAAGCCTAAGTCTTCG
TCAAAGAAGGTTCGCAAGCAGAATGGCAAAAACTTGAATATCCTCACTTCATCCACTGCTCAACCTACTCTCGAA
TCAACGGTTGCAGAAGGACCGTCCGCTGTAAAGCAGCTGGCTGCCACCAAGCGAACTCCAGCCCCTGACTCGCCC
AACACTGAGGATAGCAACACGCCAGGAGGCAAGACCAAGGGAGTTAGAAGCTCGCGCATTAGGGAGAGGGACAAT
TTGAAAATTGGCTTCTATACGCCGGATGAAGTGCGAAAAATCGAAGCGTACAAAGTCAATGTCTGTACCATGCAT
GGCATTCCTAGTGCCAAATTCGACGAGATGGTTCAGCATTCTGAGCGTACCCGTGAATTAAGCGTCGAATCTCCA
TTCTTCTCATATGGCATCCTCAAAGGCGACTTTTGGGACGAGATCTACGCTCTTCTTCCGGATCGTGATCGGCGA
TCTGTATACCGATTCATGCGTCGACACTTCCAAGCTTCGGCTCAAAGGGCACACGAATGGTCGAAGGAACAAGAT
GATGAGCTTATCGAGCTCCACGCCCAACACGGTCCGAAATGGACTTTCATTGGTAAGCTCATTGGGCGCAGTGAT
GACGATGTCACTCAGCGCTGGAAGAACAAGCTCGAGCACCAGAACACCATGAACCAAGGTGCGTGGTCGGAGGAA
GAACACAAGATGTTCCTTGACGCCGTGGAATCAACGTGGGTCACCATGAAGCCAATGCTTCCCGATAAGGCAGGC
AAGGACATGTACGAGCTGGATGAGCGCCTCATTGTATGGGGTAACATTAGCAAGGAGATTGGTTATGTGCGGTCT
CGACAACAATGTGCAGACAAATGGCGCAAGATCGTGAAACAGGTCATGGTCCTGCGGGCCAATGGCCAGCCAGAC
GCGGTGTTCGATCCCAAACTCGCTGCTAAGAAAAGTGCCCACTGGAACATGAGATTGGAGACGCAAAGGAAGAGC
TCTCAATTCGTGAACGAGGATACTGATGACGACGAGGACATGATAACTACCACCCCGAGCTCAAAGCCCCATGAT
GAGGCAGCACCATCTTCCATTGTCAATGCCAATGCCGAGTCTGACCACGAAGCGCAGTCTAAAGAGGGTGAGCCC
AACTTGCCCGCACCTCTCAAAAATGATATGAAGTCAAAATTTAAGCGCAAGCACAATGAAGATTCCGCGTCCGGT
CCCATCGAGAAAGCCCCGTCATCTCCCGGCGCCCCCCAAAAGAGCAAGGAGGAGAGGAAGCGCGAGAAGAAGGAG
AGGAAGGAGAGGAAACGCGAGAAGAAGGAGCAACGAGAGAAGAAGAGGCAAGAGAAAGAAAAGGGAGAGCAGATT
GAGCAAGAAGTCCCGGAAGACAAGGCCGCACGCAAAGAGCAAAAGTGGAAGAGGAGGGAGGAGAAGAAGAAGCGA
AAGATATTAGAAGAGGAACGTCTCGCTGCCGAGGAGGCTAACCAGGCATCTGGCAGTAATGAATCCCCTAAGGAG
AAGAAAAAGTCCAAGAAGCAGAAACAAGCTTCCATTGGCAGCCCTACCTCTTTGGTCAAGCCCTCTCATTCTGTT
GTCGAAGCATTCCCATTGCCCACATCACCTGTTTCTCACGGTGCTGATGCTGTCGATGATGAATATGACTCAGAC
GGCGGAGATGAGGACAGCGAAGTTTACTTCAAGTACGAGAGTGACTCGGAAGAGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail