Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2629.t1
Gene name
Locationscaffold_03:535438..537122
Strand+
Gene length (bp)1684
Transcript length (bp)1632
Coding sequence length (bp)1632
Protein length (aa) 544

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07156 Prenylcys_lyase Prenylcysteine lyase 1.6E-97 153 533
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.8E-12 46 112
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 1.6E-11 56 353

GO

GO Term Description Terminal node
GO:0030328 prenylcysteine catabolic process Yes
GO:0016670 oxidoreductase activity, acting on a sulfur group of donors, oxygen as acceptor Yes
GO:0055114 oxidation-reduction process Yes
GO:0016491 oxidoreductase activity Yes
GO:0016054 organic acid catabolic process No
GO:0046395 carboxylic acid catabolic process No
GO:0044238 primary metabolic process No
GO:0009056 catabolic process No
GO:0003824 catalytic activity No
GO:0000096 sulfur amino acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901575 organic substance catabolic process No
GO:0043436 oxoacid metabolic process No
GO:0044248 cellular catabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0006790 sulfur compound metabolic process No
GO:0000098 sulfur amino acid catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0030329 prenylcysteine metabolic process No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0044282 small molecule catabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0008152 metabolic process No
GO:0044281 small molecule metabolic process No
GO:0008150 biological_process No
GO:0044273 sulfur compound catabolic process No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0009063 cellular amino acid catabolic process No
GO:0006575 cellular modified amino acid metabolic process No
GO:0042219 cellular modified amino acid catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2629.t1
MWPSMPWHIPLLLYSILAALLVSFGNAAEQEQLREAASATPKRVAIIGAGAGGSFAAYQLRKLADEANIPVEITV
YERESYVGGRSTTVNVFDDPSYPIELGASIFVQINYNLVNASRDLGLTVNSADHARPRETAESIGIWDGTQFVFT
LTNSYSWWNIGRLFWRYGLAPLRTQNLVKSVVGRFLRLYEEPLFPFSSLTEAAIAADLINATASPGDVFLRANEI
SSLFANEIIQASTRVNYGQNLQLIHGLESVVCMATDGAVSIEGGNWRIFDGALRASEVNIKVNTTATEISRNDDG
TVRVSSKVNTATSSEHELFDEVVIAGPLQYSGISVSPPLENTPDEIPYVNLHVTLFASPHRISPKYFGLNDSNAR
APETILTTLPKGVDLGSNPDGVGLTEFWSISTLRRVDHSVAGSKDKQQHYVYKIFSPERPTAEFIAQILGLESEI
AGSNTTIGDLSIGDISWFHEKLWNPYPLLYPRVTFEETLLAPGVWYTGGIESFISTMETSALMGRNVATLMFQSW
QKQGDQTDSDASSWDREL*
Coding >Pro_DTO377G3_2|g2629.t1
ATGTGGCCGTCTATGCCATGGCATATCCCTCTCTTACTGTACTCCATCCTAGCTGCCCTACTCGTCTCGTTTGGC
AATGCAGCAGAACAAGAGCAACTGCGAGAAGCCGCCAGTGCAACCCCAAAGCGTGTGGCAATAATCGGCGCCGGA
GCCGGAGGCTCGTTTGCTGCATATCAACTGCGCAAGCTGGCAGATGAAGCCAACATTCCTGTGGAAATCACAGTC
TATGAGCGTGAATCATATGTTGGCGGCCGCTCAACAACAGTCAATGTATTCGACGACCCATCGTACCCCATTGAA
CTGGGTGCTTCCATTTTTGTCCAGATCAATTACAACCTGGTCAACGCTTCCCGTGATCTCGGCCTGACGGTCAAT
AGTGCTGACCATGCACGGCCTAGGGAGACTGCTGAGAGTATCGGGATCTGGGATGGGACCCAGTTCGTTTTCACG
TTGACGAATTCGTATAGCTGGTGGAATATCGGCCGGCTCTTCTGGCGTTATGGACTGGCGCCTCTGCGTACTCAG
AATCTGGTAAAGAGTGTCGTTGGCAGGTTTCTCCGCCTTTATGAAGAGCCTTTATTCCCTTTCAGCTCTCTTACT
GAGGCAGCTATTGCGGCTGACTTGATCAATGCTACTGCATCTCCTGGCGATGTGTTTCTCCGGGCAAATGAAATC
AGCTCGCTGTTTGCGAATGAGATCATCCAAGCAAGTACTCGAGTGAATTATGGACAGAACCTGCAGCTGATTCAT
GGCTTGGAATCTGTCGTCTGTATGGCTACGGATGGAGCGGTTTCTATCGAGGGTGGAAATTGGCGCATTTTCGAT
GGCGCGCTGAGGGCCTCGGAGGTGAATATCAAAGTGAATACCACCGCCACTGAGATTTCACGCAACGATGATGGG
ACTGTACGGGTCTCCTCAAAGGTCAACACCGCTACCAGCTCCGAGCATGAGCTATTCGACGAAGTTGTCATTGCC
GGTCCTTTGCAGTACTCGGGTATCTCCGTCTCCCCTCCCTTGGAAAACACTCCAGATGAGATTCCATATGTCAAC
TTGCACGTTACTCTCTTTGCATCCCCTCACCGCATCTCGCCGAAGTATTTTGGTCTGAACGATTCAAATGCTCGA
GCGCCCGAGACTATTCTGACCACTCTACCCAAGGGCGTTGATCTGGGTTCGAACCCAGATGGTGTTGGCCTCACT
GAATTTTGGAGTATTAGTACACTTCGAAGAGTAGATCATTCTGTTGCGGGTTCCAAAGACAAACAGCAACATTAT
GTTTACAAAATCTTCTCGCCAGAGCGGCCCACGGCTGAATTCATTGCCCAGATTCTGGGGCTGGAGAGTGAGATT
GCGGGGAGCAATACGACCATTGGAGACCTATCGATAGGCGATATCAGCTGGTTCCATGAGAAGCTATGGAACCCA
TACCCTCTTCTGTATCCGCGAGTGACCTTTGAGGAGACTCTTCTAGCTCCAGGTGTGTGGTACACAGGTGGCATC
GAGAGCTTCATCTCGACAATGGAGACTAGTGCGTTGATGGGCCGGAACGTGGCAACTCTCATGTTCCAGTCGTGG
CAGAAGCAAGGAGATCAGACAGACAGTGATGCCTCGTCCTGGGACAGGGAGCTGTAA
Transcript >Pro_DTO377G3_2|g2629.t1
ATGTGGCCGTCTATGCCATGGCATATCCCTCTCTTACTGTACTCCATCCTAGCTGCCCTACTCGTCTCGTTTGGC
AATGCAGCAGAACAAGAGCAACTGCGAGAAGCCGCCAGTGCAACCCCAAAGCGTGTGGCAATAATCGGCGCCGGA
GCCGGAGGCTCGTTTGCTGCATATCAACTGCGCAAGCTGGCAGATGAAGCCAACATTCCTGTGGAAATCACAGTC
TATGAGCGTGAATCATATGTTGGCGGCCGCTCAACAACAGTCAATGTATTCGACGACCCATCGTACCCCATTGAA
CTGGGTGCTTCCATTTTTGTCCAGATCAATTACAACCTGGTCAACGCTTCCCGTGATCTCGGCCTGACGGTCAAT
AGTGCTGACCATGCACGGCCTAGGGAGACTGCTGAGAGTATCGGGATCTGGGATGGGACCCAGTTCGTTTTCACG
TTGACGAATTCGTATAGCTGGTGGAATATCGGCCGGCTCTTCTGGCGTTATGGACTGGCGCCTCTGCGTACTCAG
AATCTGGTAAAGAGTGTCGTTGGCAGGTTTCTCCGCCTTTATGAAGAGCCTTTATTCCCTTTCAGCTCTCTTACT
GAGGCAGCTATTGCGGCTGACTTGATCAATGCTACTGCATCTCCTGGCGATGTGTTTCTCCGGGCAAATGAAATC
AGCTCGCTGTTTGCGAATGAGATCATCCAAGCAAGTACTCGAGTGAATTATGGACAGAACCTGCAGCTGATTCAT
GGCTTGGAATCTGTCGTCTGTATGGCTACGGATGGAGCGGTTTCTATCGAGGGTGGAAATTGGCGCATTTTCGAT
GGCGCGCTGAGGGCCTCGGAGGTGAATATCAAAGTGAATACCACCGCCACTGAGATTTCACGCAACGATGATGGG
ACTGTACGGGTCTCCTCAAAGGTCAACACCGCTACCAGCTCCGAGCATGAGCTATTCGACGAAGTTGTCATTGCC
GGTCCTTTGCAGTACTCGGGTATCTCCGTCTCCCCTCCCTTGGAAAACACTCCAGATGAGATTCCATATGTCAAC
TTGCACGTTACTCTCTTTGCATCCCCTCACCGCATCTCGCCGAAGTATTTTGGTCTGAACGATTCAAATGCTCGA
GCGCCCGAGACTATTCTGACCACTCTACCCAAGGGCGTTGATCTGGGTTCGAACCCAGATGGTGTTGGCCTCACT
GAATTTTGGAGTATTAGTACACTTCGAAGAGTAGATCATTCTGTTGCGGGTTCCAAAGACAAACAGCAACATTAT
GTTTACAAAATCTTCTCGCCAGAGCGGCCCACGGCTGAATTCATTGCCCAGATTCTGGGGCTGGAGAGTGAGATT
GCGGGGAGCAATACGACCATTGGAGACCTATCGATAGGCGATATCAGCTGGTTCCATGAGAAGCTATGGAACCCA
TACCCTCTTCTGTATCCGCGAGTGACCTTTGAGGAGACTCTTCTAGCTCCAGGTGTGTGGTACACAGGTGGCATC
GAGAGCTTCATCTCGACAATGGAGACTAGTGCGTTGATGGGCCGGAACGTGGCAACTCTCATGTTCCAGTCGTGG
CAGAAGCAAGGAGATCAGACAGACAGTGATGCCTCGTCCTGGGACAGGGAGCTGTAA
Gene >Pro_DTO377G3_2|g2629.t1
ATGTGGCCGTCTATGCCATGGCATATCCCTCTCTTACTGTACTCCATCCTAGCTGCCCTACTCGTCTCGTTTGGC
AATGCAGCAGAACAAGAGCAACTGCGAGAAGCCGCCAGTGCAACCCCAAAGCGTGTGGCAATAATCGGTATGCCT
CTCTCTAAAGAACACAGTTCCATACGGGGCTGATACTCCCATAGGCGCCGGAGCCGGAGGCTCGTTTGCTGCATA
TCAACTGCGCAAGCTGGCAGATGAAGCCAACATTCCTGTGGAAATCACAGTCTATGAGCGTGAATCATATGTTGG
CGGCCGCTCAACAACAGTCAATGTATTCGACGACCCATCGTACCCCATTGAACTGGGTGCTTCCATTTTTGTCCA
GATCAATTACAACCTGGTCAACGCTTCCCGTGATCTCGGCCTGACGGTCAATAGTGCTGACCATGCACGGCCTAG
GGAGACTGCTGAGAGTATCGGGATCTGGGATGGGACCCAGTTCGTTTTCACGTTGACGAATTCGTATAGCTGGTG
GAATATCGGCCGGCTCTTCTGGCGTTATGGACTGGCGCCTCTGCGTACTCAGAATCTGGTAAAGAGTGTCGTTGG
CAGGTTTCTCCGCCTTTATGAAGAGCCTTTATTCCCTTTCAGCTCTCTTACTGAGGCAGCTATTGCGGCTGACTT
GATCAATGCTACTGCATCTCCTGGCGATGTGTTTCTCCGGGCAAATGAAATCAGCTCGCTGTTTGCGAATGAGAT
CATCCAAGCAAGTACTCGAGTGAATTATGGACAGAACCTGCAGCTGATTCATGGCTTGGAATCTGTCGTCTGTAT
GGCTACGGATGGAGCGGTTTCTATCGAGGGTGGAAATTGGCGCATTTTCGATGGCGCGCTGAGGGCCTCGGAGGT
GAATATCAAAGTGAATACCACCGCCACTGAGATTTCACGCAACGATGATGGGACTGTACGGGTCTCCTCAAAGGT
CAACACCGCTACCAGCTCCGAGCATGAGCTATTCGACGAAGTTGTCATTGCCGGTCCTTTGCAGTACTCGGGTAT
CTCCGTCTCCCCTCCCTTGGAAAACACTCCAGATGAGATTCCATATGTCAACTTGCACGTTACTCTCTTTGCATC
CCCTCACCGCATCTCGCCGAAGTATTTTGGTCTGAACGATTCAAATGCTCGAGCGCCCGAGACTATTCTGACCAC
TCTACCCAAGGGCGTTGATCTGGGTTCGAACCCAGATGGTGTTGGCCTCACTGAATTTTGGAGTATTAGTACACT
TCGAAGAGTAGATCATTCTGTTGCGGGTTCCAAAGACAAACAGCAACATTATGTTTACAAAATCTTCTCGCCAGA
GCGGCCCACGGCTGAATTCATTGCCCAGATTCTGGGGCTGGAGAGTGAGATTGCGGGGAGCAATACGACCATTGG
AGACCTATCGATAGGCGATATCAGCTGGTTCCATGAGAAGCTATGGAACCCATACCCTCTTCTGTATCCGCGAGT
GACCTTTGAGGAGACTCTTCTAGCTCCAGGTGTGTGGTACACAGGTGGCATCGAGAGCTTCATCTCGACAATGGA
GACTAGTGCGTTGATGGGCCGGAACGTGGCAACTCTCATGTTCCAGTCGTGGCAGAAGCAAGGAGATCAGACAGA
CAGTGATGCCTCGTCCTGGGACAGGGAGCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail