Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2621.t1
Gene name
Locationscaffold_03:515084..516820
Strand+
Gene length (bp)1736
Transcript length (bp)1554
Coding sequence length (bp)1554
Protein length (aa) 518

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06415 iPGM_N BPG-independent PGAM N-terminus (iPGM_N) 1.2E-74 90 302
PF01676 Metalloenzyme Metalloenzyme superfamily 8.3E-70 5 503
PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase 2.9E-07 377 452

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0005737 cytoplasm Yes
GO:0006007 glucose catabolic process Yes
GO:0030145 manganese ion binding Yes
GO:0004619 phosphoglycerate mutase activity Yes
GO:0046872 metal ion binding Yes
GO:0071704 organic substance metabolic process No
GO:0005575 cellular_component No
GO:0019318 hexose metabolic process No
GO:0044282 small molecule catabolic process No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0009056 catabolic process No
GO:0046365 monosaccharide catabolic process No
GO:0003674 molecular_function No
GO:0046914 transition metal ion binding No
GO:0044238 primary metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0006006 glucose metabolic process No
GO:0044281 small molecule metabolic process No
GO:0016866 intramolecular transferase activity No
GO:1901575 organic substance catabolic process No
GO:0005996 monosaccharide metabolic process No
GO:0016853 isomerase activity No
GO:0043169 cation binding No
GO:0110165 cellular anatomical entity No
GO:0016868 intramolecular transferase activity, phosphotransferases No
GO:0019320 hexose catabolic process No
GO:0016052 carbohydrate catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2621.t1
MADQKVALIVIDGWGIAGPDSPPQGDAIAAADTPHMSGFAEPNSKTAQGYAELEASSLAVGLPEGLMGNSEVGHL
NIGAGRVVWQDSVRIDQTLKKGEMGKVPSIVKAFTRAKEGNGRLHLLGLVSDGGVHSSIAHLFALLQVAKDMQIP
EVFIHFFADGRDTDPKSADKFLQQVLDKTQEIGVGVIATIVGRYYIMDRDKRWERVEIGLKGLVTGEGEDSSDPL
QTIKERYEKNENDEFLKPIIVGGKERRVQDDDTLFFFNYRSDRVREITQLLGDYDRSPLPDFPYPKNISLTTMTQ
YKTDYNFNVAFPPQHMGNVLAEWLGKKNLQQCHIAETEKYAHVTFFFNGGIEKVFPGEVRDMIPSPRVATYDLDP
KMSAAAVGDKMAERLGENKFDFVMNNFAPPDMVGHTGVYEAAIQGVAATDKAIGEIYEACKKNNYVLFITADHGN
AEEMLTEKGTPKTSHTLNKVPFVMANAPESWSLKKDGVLGDVAPTVLAAMGVEQPKEMTGTSLLVKS*
Coding >Pro_DTO377G3_2|g2621.t1
ATGGCCGACCAAAAAGTTGCTTTGATTGTGATTGATGGCTGGGGTATTGCAGGCCCCGACTCCCCACCCCAGGGA
GATGCAATCGCCGCGGCCGATACCCCACACATGTCCGGCTTCGCTGAGCCCAACTCCAAGACTGCCCAAGGCTAT
GCCGAGTTAGAAGCCTCCTCGCTGGCAGTTGGTCTGCCCGAGGGTCTGATGGGCAACAGTGAGGTCGGTCACCTG
AACATTGGTGCTGGCCGTGTTGTCTGGCAGGACAGTGTTCGCATTGACCAGACCCTCAAGAAGGGCGAGATGGGC
AAGGTGCCCAGCATTGTCAAGGCTTTCACTCGCGCAAAGGAGGGCAATGGACGTCTGCACCTTCTGGGCTTGGTC
TCAGATGGTGGTGTTCACTCCAGCATCGCTCACCTATTCGCCTTGCTCCAGGTCGCCAAGGACATGCAGATTCCC
GAGGTCTTCATCCACTTCTTCGCCGATGGACGTGATACCGACCCTAAGAGCGCCGACAAGTTCTTGCAGCAAGTG
CTTGACAAGACCCAGGAGATCGGTGTCGGTGTGATTGCGACTATCGTGGGCCGCTACTATATCATGGACCGCGAC
AAGCGCTGGGAGCGTGTTGAGATTGGCCTCAAGGGTCTGGTCACTGGCGAGGGCGAGGACAGCTCGGACCCGCTA
CAGACCATCAAGGAGCGCTACGAGAAGAATGAGAACGATGAGTTCCTGAAGCCCATCATTGTTGGCGGCAAGGAG
CGCCGTGTCCAGGATGATGATACCCTCTTCTTCTTCAACTACCGCTCGGATCGTGTCCGTGAAATCACTCAGCTG
CTGGGCGACTATGACCGTTCCCCCCTTCCGGACTTCCCCTACCCCAAGAACATCTCCCTTACCACCATGACCCAG
TACAAAACTGACTACAACTTCAATGTTGCTTTCCCCCCGCAACATATGGGTAACGTGCTGGCCGAATGGCTCGGC
AAGAAGAACCTCCAGCAGTGCCATATTGCGGAGACTGAGAAGTATGCTCACGTCACTTTCTTCTTCAACGGTGGT
ATCGAGAAGGTCTTCCCCGGAGAAGTGCGCGATATGATCCCTTCGCCCCGAGTTGCTACCTACGATCTTGATCCA
AAGATGAGTGCAGCTGCTGTCGGTGATAAGATGGCTGAACGCCTCGGCGAGAACAAGTTCGACTTTGTCATGAAC
AACTTCGCCCCTCCTGACATGGTTGGCCACACTGGCGTGTACGAGGCCGCCATCCAGGGTGTTGCTGCCACCGAC
AAGGCGATTGGTGAGATCTATGAGGCCTGCAAGAAGAACAACTACGTTCTATTCATCACCGCCGATCATGGAAAC
GCCGAGGAGATGCTCACCGAGAAGGGTACCCCCAAGACCTCCCACACCCTTAATAAGGTTCCCTTTGTTATGGCC
AACGCCCCTGAGAGTTGGAGCCTTAAGAAGGACGGTGTCTTGGGTGATGTTGCACCTACCGTTCTCGCAGCCATG
GGCGTCGAGCAACCCAAGGAGATGACCGGTACCAGTCTGCTGGTCAAGTCCTAG
Transcript >Pro_DTO377G3_2|g2621.t1
ATGGCCGACCAAAAAGTTGCTTTGATTGTGATTGATGGCTGGGGTATTGCAGGCCCCGACTCCCCACCCCAGGGA
GATGCAATCGCCGCGGCCGATACCCCACACATGTCCGGCTTCGCTGAGCCCAACTCCAAGACTGCCCAAGGCTAT
GCCGAGTTAGAAGCCTCCTCGCTGGCAGTTGGTCTGCCCGAGGGTCTGATGGGCAACAGTGAGGTCGGTCACCTG
AACATTGGTGCTGGCCGTGTTGTCTGGCAGGACAGTGTTCGCATTGACCAGACCCTCAAGAAGGGCGAGATGGGC
AAGGTGCCCAGCATTGTCAAGGCTTTCACTCGCGCAAAGGAGGGCAATGGACGTCTGCACCTTCTGGGCTTGGTC
TCAGATGGTGGTGTTCACTCCAGCATCGCTCACCTATTCGCCTTGCTCCAGGTCGCCAAGGACATGCAGATTCCC
GAGGTCTTCATCCACTTCTTCGCCGATGGACGTGATACCGACCCTAAGAGCGCCGACAAGTTCTTGCAGCAAGTG
CTTGACAAGACCCAGGAGATCGGTGTCGGTGTGATTGCGACTATCGTGGGCCGCTACTATATCATGGACCGCGAC
AAGCGCTGGGAGCGTGTTGAGATTGGCCTCAAGGGTCTGGTCACTGGCGAGGGCGAGGACAGCTCGGACCCGCTA
CAGACCATCAAGGAGCGCTACGAGAAGAATGAGAACGATGAGTTCCTGAAGCCCATCATTGTTGGCGGCAAGGAG
CGCCGTGTCCAGGATGATGATACCCTCTTCTTCTTCAACTACCGCTCGGATCGTGTCCGTGAAATCACTCAGCTG
CTGGGCGACTATGACCGTTCCCCCCTTCCGGACTTCCCCTACCCCAAGAACATCTCCCTTACCACCATGACCCAG
TACAAAACTGACTACAACTTCAATGTTGCTTTCCCCCCGCAACATATGGGTAACGTGCTGGCCGAATGGCTCGGC
AAGAAGAACCTCCAGCAGTGCCATATTGCGGAGACTGAGAAGTATGCTCACGTCACTTTCTTCTTCAACGGTGGT
ATCGAGAAGGTCTTCCCCGGAGAAGTGCGCGATATGATCCCTTCGCCCCGAGTTGCTACCTACGATCTTGATCCA
AAGATGAGTGCAGCTGCTGTCGGTGATAAGATGGCTGAACGCCTCGGCGAGAACAAGTTCGACTTTGTCATGAAC
AACTTCGCCCCTCCTGACATGGTTGGCCACACTGGCGTGTACGAGGCCGCCATCCAGGGTGTTGCTGCCACCGAC
AAGGCGATTGGTGAGATCTATGAGGCCTGCAAGAAGAACAACTACGTTCTATTCATCACCGCCGATCATGGAAAC
GCCGAGGAGATGCTCACCGAGAAGGGTACCCCCAAGACCTCCCACACCCTTAATAAGGTTCCCTTTGTTATGGCC
AACGCCCCTGAGAGTTGGAGCCTTAAGAAGGACGGTGTCTTGGGTGATGTTGCACCTACCGTTCTCGCAGCCATG
GGCGTCGAGCAACCCAAGGAGATGACCGGTACCAGTCTGCTGGTCAAGTCCTAG
Gene >Pro_DTO377G3_2|g2621.t1
ATGGCCGACCAAAAAGTTGCTTTGAGTATGGTCGACTGCCACCCAGGTCCTCAAAAAGATATACCGCTAATGTAC
GTCTCAAAGTTGTGATTGATGGCTGGGGTATTGCAGGCCCCGACTCCCCACCCCAGGGAGATGCAATCGCCGCGG
CCGATACCCCACACATGTCCGGCTTCGCTGAGCCCAACTCCAAGACTGCCCAAGGCTATGCCGAGTTAGAAGCCT
CCTCGCTGGCAGTTGGTCTGCCCGAGGGTCTGATGGGCAACAGTGAGGTCGGTCACCTGAACATTGGTGCTGGCC
GTGTTGTCTGGCAGGACAGTGTTCGCATTGACCAGACCCTCAAGAAGGGCGAGATGGGCAAGGTGCCCAGCATTG
TCAAGGCTTTCACTCGCGCAAAGGAGGGCAATGGACGTCTGCACCTTCTGGGCTTGGTCTCAGATGGTGGTGTTC
ACTCCAGCATCGCTCACCTATTCGCCTTGCTCCAGGTCGCCAAGGACATGCAGATTCCCGAGGTCTTCATCCACT
TCTTCGCCGATGGACGTGATACCGACCCTAAGAGCGCCGACAAGTTCTTGCAGCAAGTGCTTGACAAGACCCAGG
AGATCGGTGTCGGTGTGATTGCGACTATCGTGGGCCGCTACTATATCATGGACCGCGACAAGCGCTGGGAGCGTG
TTGAGATTGGCCTCAAGGGTCTGGTCACTGGCGAGGGCGAGGACAGCTCGGACCCGCTACAGACCATCAAGGAGC
GCTACGAGAAGAATGAGAACGATGAGTTCCTGAAGCCCATCATTGTTGGCGGCAAGGAGCGCCGTGTCCAGGGTG
CGTTTGGTCCAAACTGAAAGGAAATGCCATGACAACTAATTGAGCCTGTATAGATGATGATACCCTCTTCTTCTT
CAACTACCGCTCGGATCGTGTCCGTGAAATCACTCAGCTGCTGGGCGACTATGACCGTTCCCCCCTTCCGGACTT
CCCCTACCCCAAGAACATCTCCCTTACCACCATGACCCAGTACAAAACTGACTACAACTTCAATGTTGCTTTCCC
CCCGCAACATATGGGTAACGTGCTGGCCGAATGGCTCGGCAAGAAGAACCTCCAGCAGTGCCATATTGCGGAGAC
TGAGAAGTATGCTCACGTCACTTTCTTCTTCAACGGTGGTATCGAGAAGGTCTTCCCCGGAGAAGTGCGCGATAT
GATCCCTTCGCCCCGAGTTGCTACCTACGATCTTGATCCAAAGATGAGTGCAGCTGCTGTCGGTGATAAGATGGC
TGAACGCCTCGGCGAGAACAAGTTCGACTTTGTCATGAACAACTTCGCCCCTCCTGACATGGTTGGCCACACTGG
CGTGTACGAGGCCGCCATCCAGGGTGTTGCTGCCACCGACAAGGCGATTGGTGAGATCTATGAGGCCTGCAAGAA
GAACAACTACGTTCTATTCATCACCGCCGATCATGGGTAAGTTATTCTGGGAAATACGATCACCTCCTATCAAAG
AGGATTGCTAGTTAACCCACATTCACAGAAACGCCGAGGAGATGCTCACCGAGAAGGGTACCCCCAAGACCTCCC
ACACCCTTAATAAGGTTCCCTTTGTTATGGCCAACGCCCCTGAGAGTTGGAGCCTTAAGAAGGACGGTGTCTTGG
GTGATGTTGCACCTACCGTTCTCGCAGCCATGGGCGTCGAGCAACCCAAGGAGATGACCGGTACCAGTCTGCTGG
TCAAGTCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail