Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g261.t1
Gene name
Locationscaffold_01:674038..675901
Strand+
Gene length (bp)1863
Transcript length (bp)1812
Coding sequence length (bp)1812
Protein length (aa) 604

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.0E-39 112 515
PF00083 Sugar_tr Sugar (and other) transporter 4.3E-08 104 274
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 9.2E-06 105 373

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 105 127 22
2 142 164 22
3 171 193 22
4 197 219 22
5 232 251 19
6 256 278 22
7 299 321 22
8 331 353 22
9 373 395 22
10 410 432 22
11 439 459 20
12 469 491 22
13 504 523 19
14 570 592 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g261.t1
MPSDNEGQSCPSEATPLLRKNSVHRKTSYHDVSYSATDVESVCSYRDTEEEEANVRCISSASSAEGLDVGPASGA
GSPNQQPNISTQDGEDYASRFIDISPTRFWIIFSGIMMGYLIGFFDSTLMASSHPVITSYFEAANSASWLSTAFL
LTSTAFMPLLGRISDAFGRKHVYLFSIAMFFLTTAGCGLAQSIGSFIAARALCGLGAGGIFSIGQIISSDLVRLE
YRGVYQSYINLCLGIGGSLGLAFGGYLCDHIGWRGAFLIQLPFIFVYFIAAAWTVPADLGIKQTGMERMKVWQLV
RSIDILGSIILIICVTLLIMGLNFGGNVYPWSHPLIIISLVSSLVLAVILVRYELHVPRPVLPIELMATDPRASI
IFGNFFASMSVHTMLFNAPLYFQAVKLTSPTASGLRLVASSIAVTISSVSTGFMINWTRRLKPYVIIGVCCMVIG
GCAAASMGIDTSQPLSMICISFSSLGQGFAFPSLMVSILATSEKQDQAVATTTLGLWRNLGAVMGVAVSSWIFQN
SLIYQLNKNVTGFEKNHIIALVRKSVDTIAHLDPIHRREVTLSYSAALQLTFISAALWAVIVLILLGRVRLPRLG
RKA*
Coding >Pro_DTO377G3_2|g261.t1
ATGCCCAGTGACAACGAGGGGCAATCATGTCCCTCTGAAGCCACCCCTCTCCTGCGCAAGAATTCGGTCCATCGG
AAAACGAGTTATCACGATGTCTCGTATTCTGCAACGGATGTTGAATCAGTCTGCTCATACAGAGATACAGAAGAA
GAAGAAGCCAACGTTCGCTGTATATCCAGTGCAAGCTCTGCCGAAGGACTCGATGTTGGTCCGGCTTCTGGGGCT
GGCTCGCCCAACCAACAGCCGAACATCTCAACCCAAGATGGGGAGGATTACGCCTCGAGATTCATTGATATATCA
CCGACAAGGTTTTGGATCATCTTTAGTGGTATCATGATGGGCTACCTGATCGGCTTCTTTGACTCAACGCTCATG
GCTTCAAGCCATCCAGTCATCACCTCCTACTTCGAAGCAGCCAACTCAGCCTCCTGGTTATCGACGGCCTTTTTG
TTGACATCGACCGCATTTATGCCGCTCTTGGGACGCATCTCTGACGCATTTGGCCGAAAGCATGTCTATCTCTTC
TCTATCGCCATGTTCTTCCTCACGACAGCAGGCTGTGGCTTAGCGCAAAGTATCGGCAGTTTCATCGCTGCCCGC
GCGCTGTGTGGGCTTGGTGCGGGTGGTATCTTCTCCATTGGTCAGATCATCTCTAGTGACTTGGTACGTCTCGAG
TATCGCGGTGTCTACCAATCATACATCAATCTGTGTCTCGGCATCGGCGGTAGCCTCGGCCTTGCCTTTGGGGGT
TACCTGTGTGATCATATCGGCTGGCGGGGTGCGTTTCTCATCCAACTGCCTTTCATCTTCGTTTACTTTATAGCA
GCCGCTTGGACAGTCCCGGCAGATCTCGGCATTAAACAAACTGGAATGGAGCGCATGAAAGTCTGGCAGTTAGTC
CGGAGCATCGATATACTGGGATCAATCATCTTGATTATATGTGTGACTCTGTTGATCATGGGTCTGAACTTCGGA
GGCAATGTCTATCCTTGGAGCCATCCACTCATTATCATCTCCCTGGTGTCATCGTTAGTCCTAGCGGTTATCTTG
GTACGTTACGAGCTGCACGTTCCACGACCCGTGCTACCAATTGAGCTCATGGCAACGGATCCTCGAGCTAGTATC
ATCTTTGGCAATTTCTTTGCCTCCATGTCTGTACACACCATGCTGTTCAATGCTCCGCTGTATTTTCAGGCGGTG
AAGCTGACCAGCCCAACTGCTTCTGGGCTACGCCTTGTGGCCTCCTCCATAGCTGTGACTATCTCTAGCGTGAGC
ACCGGGTTCATGATTAACTGGACCAGACGTCTCAAACCTTATGTCATCATCGGTGTATGTTGTATGGTGATAGGT
GGATGTGCAGCTGCATCCATGGGGATTGACACCTCTCAACCACTCTCCATGATCTGCATCTCATTCTCCAGTCTA
GGTCAGGGCTTCGCATTTCCCAGCTTGATGGTATCTATCCTCGCCACGAGCGAGAAACAAGATCAGGCCGTCGCA
ACAACCACTCTGGGGCTGTGGAGAAACCTTGGCGCCGTGATGGGTGTGGCTGTCAGCAGCTGGATCTTTCAGAAC
AGTCTCATATACCAGCTTAACAAAAATGTTACTGGTTTTGAGAAGAACCATATCATTGCACTTGTCCGCAAATCT
GTTGATACTATCGCTCACTTGGATCCAATCCATCGGCGAGAAGTCACTCTATCATATTCCGCCGCTCTTCAACTG
ACCTTCATATCTGCCGCCTTATGGGCAGTCATTGTGTTAATATTGTTGGGTCGAGTCCGACTACCGCGGTTGGGG
AGAAAGGCCTAG
Transcript >Pro_DTO377G3_2|g261.t1
ATGCCCAGTGACAACGAGGGGCAATCATGTCCCTCTGAAGCCACCCCTCTCCTGCGCAAGAATTCGGTCCATCGG
AAAACGAGTTATCACGATGTCTCGTATTCTGCAACGGATGTTGAATCAGTCTGCTCATACAGAGATACAGAAGAA
GAAGAAGCCAACGTTCGCTGTATATCCAGTGCAAGCTCTGCCGAAGGACTCGATGTTGGTCCGGCTTCTGGGGCT
GGCTCGCCCAACCAACAGCCGAACATCTCAACCCAAGATGGGGAGGATTACGCCTCGAGATTCATTGATATATCA
CCGACAAGGTTTTGGATCATCTTTAGTGGTATCATGATGGGCTACCTGATCGGCTTCTTTGACTCAACGCTCATG
GCTTCAAGCCATCCAGTCATCACCTCCTACTTCGAAGCAGCCAACTCAGCCTCCTGGTTATCGACGGCCTTTTTG
TTGACATCGACCGCATTTATGCCGCTCTTGGGACGCATCTCTGACGCATTTGGCCGAAAGCATGTCTATCTCTTC
TCTATCGCCATGTTCTTCCTCACGACAGCAGGCTGTGGCTTAGCGCAAAGTATCGGCAGTTTCATCGCTGCCCGC
GCGCTGTGTGGGCTTGGTGCGGGTGGTATCTTCTCCATTGGTCAGATCATCTCTAGTGACTTGGTACGTCTCGAG
TATCGCGGTGTCTACCAATCATACATCAATCTGTGTCTCGGCATCGGCGGTAGCCTCGGCCTTGCCTTTGGGGGT
TACCTGTGTGATCATATCGGCTGGCGGGGTGCGTTTCTCATCCAACTGCCTTTCATCTTCGTTTACTTTATAGCA
GCCGCTTGGACAGTCCCGGCAGATCTCGGCATTAAACAAACTGGAATGGAGCGCATGAAAGTCTGGCAGTTAGTC
CGGAGCATCGATATACTGGGATCAATCATCTTGATTATATGTGTGACTCTGTTGATCATGGGTCTGAACTTCGGA
GGCAATGTCTATCCTTGGAGCCATCCACTCATTATCATCTCCCTGGTGTCATCGTTAGTCCTAGCGGTTATCTTG
GTACGTTACGAGCTGCACGTTCCACGACCCGTGCTACCAATTGAGCTCATGGCAACGGATCCTCGAGCTAGTATC
ATCTTTGGCAATTTCTTTGCCTCCATGTCTGTACACACCATGCTGTTCAATGCTCCGCTGTATTTTCAGGCGGTG
AAGCTGACCAGCCCAACTGCTTCTGGGCTACGCCTTGTGGCCTCCTCCATAGCTGTGACTATCTCTAGCGTGAGC
ACCGGGTTCATGATTAACTGGACCAGACGTCTCAAACCTTATGTCATCATCGGTGTATGTTGTATGGTGATAGGT
GGATGTGCAGCTGCATCCATGGGGATTGACACCTCTCAACCACTCTCCATGATCTGCATCTCATTCTCCAGTCTA
GGTCAGGGCTTCGCATTTCCCAGCTTGATGGTATCTATCCTCGCCACGAGCGAGAAACAAGATCAGGCCGTCGCA
ACAACCACTCTGGGGCTGTGGAGAAACCTTGGCGCCGTGATGGGTGTGGCTGTCAGCAGCTGGATCTTTCAGAAC
AGTCTCATATACCAGCTTAACAAAAATGTTACTGGTTTTGAGAAGAACCATATCATTGCACTTGTCCGCAAATCT
GTTGATACTATCGCTCACTTGGATCCAATCCATCGGCGAGAAGTCACTCTATCATATTCCGCCGCTCTTCAACTG
ACCTTCATATCTGCCGCCTTATGGGCAGTCATTGTGTTAATATTGTTGGGTCGAGTCCGACTACCGCGGTTGGGG
AGAAAGGCCTAG
Gene >Pro_DTO377G3_2|g261.t1
ATGCCCAGTGACAACGAGGGGCAATCATGTCCCTCTGAAGCCACCCCTCTCCTGCGCAAGAATTCGGTCCATCGG
AAAACGAGTTATCACGATGTCTCGTATTCTGCAACGGATGTTGAATCAGTCTGCTCATACAGAGATACAGAAGAA
GAAGAAGCCAACGTTCGCTGTATATCCAGTGCAAGCTCTGCCGAAGGACTCGATGTTGGTCCGGCTTCTGGGGCT
GGCTCGCCCAACCAACAGCCGAACATCTCAACCCAAGATGGGGAGGATTACGCCTCGAGATTCATTGATATATCA
CCGACAAGGTTTTGGATCATCTTTAGTGGTATCATGATGGGCTACCTGATCGGCTTCTTTGACTCAACGCTCATG
GCTTCAAGCCATCCAGTCATCACCTCCTACTTCGAAGCAGCCAACTCAGCCTCCTGGTTATCGACGGCCTTTTTG
TTGACATCGACCGCATTTATGCCGCTCTTGGGACGCATCTCTGACGCATTTGGCCGAAAGCATGTCTATCTCTTC
TCTATCGCCATGTTCTTCCTCACGACAGCAGGCTGTGGCTTAGCGCAAAGTATCGGCAGTTTCATCGCTGCCCGC
GCGCTGTGTGGGCTTGGTGCGGGTGGTATCTTCTCCATTGGTCAGATCATCTCTAGTGACTTGGTACGTCTCGAG
TATCGCGGTGTCTACCAATCATACATCAATCTGTGTCTCGGCATCGGCGGTAGCCTCGGCCTTGCCTTTGGGGGT
TACCTGTGTGATCATATCGGCTGGCGGGGTGCGTTTCTCATCCAACTGCCTTTCATCTTCGTTTACTTTATAGCA
GCCGCTTGGACAGTCCCGGCAGATCTCGGCATTAAACAAACTGGAATGGAGCGCATGAAAGTCTGGCAGTTAGTC
CGGAGCATCGATATACTGGGATCAATCATCTTGATTATATGTGTGACTCTGTTGATCATGGGTCTGAACTTCGGA
GGCAATGTCTATCCTTGGAGCCATCCACTCATTATCATCTCCCTGGTGTCATCGTTAGTCCTAGCGGTTATCTTG
GTACGTTACGAGCTGCACGTTCCACGACCCGTGCTACCAATTGAGCTCATGGCAACGGATCCTCGAGCTAGTATC
ATCTTTGGCAATTTCTTTGCCTCCATGTCTGTACACACCATGCTGTTCAATGCTCCGCTGTATTTTCAGGCGGTG
AAGCTGACCAGCCCAACTGCTTCTGGGCTACGCCTTGTGGCCTCCTCCATAGCTGTGACTATCTCTAGCGTGAGC
ACCGGGTTCATGATTAACTGGACCAGACGTCTCAAACCTTATGTCATCATCGGTGTATGTTGTATGGTGATAGGT
GGATGTGCAGCTGCATCCATGGGGATTGACACCTCTCAACCACTCTCCATGATCTGCATCTCATTCTCCAGTCTA
GGTCAGGGCTTCGCATTTCCCAGCTTGATGGTATCTATCCTCGCCACGAGCGAGAAACAAGATCAGGCCGTCGCA
ACAACCACTCTGGGGCTGTGGAGAAACCTTGGCGCCGTGATGGGTGTGGCTGTCAGCAGCTGGATCTTTCAGAAC
AGTCTCATATACCAGCTTAACAAAAATGTTACTGGTTTTGAGAAGAACCATATCATTGCACTTGTCCGCAAATCT
GTTGATACTATCGCTCACTTGGATCCAATCCATCGGCGAGAAGGTGTGTCTCATCCCCTTGGAATGCCGATTTGA
TTTGCTAATAACCACCCAGTCACTCTATCATATTCCGCCGCTCTTCAACTGACCTTCATATCTGCCGCCTTATGG
GCAGTCATTGTGTTAATATTGTTGGGTCGAGTCCGACTACCGCGGTTGGGGAGAAAGGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail