Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2608.t1
Gene name
Locationscaffold_03:487255..490145
Strand-
Gene length (bp)2890
Transcript length (bp)2838
Coding sequence length (bp)2838
Protein length (aa) 946

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.4E-10 494 563

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 92.16 55.60 128.73
5d_25C Five days - 25 degrees Celsius 116.42 69.14 163.69
7d_25C Seven days - 25 degrees Celsius 120.19 70.61 169.77
10d_25C Ten days - 25 degrees Celsius 165.94 96.14 235.73
7d_15C Seven days - 15 degrees Celsius 139.32 80.62 198.01
7d_30C Seven days - 30 degrees Celsius 130.82 77.71 183.94

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.342182 no
3d_25C 7d_25C 0.266251 no
3d_25C 7d_15C 0.062630 no
3d_25C 7d_30C 0.110900 no
3d_25C 10d_25C 0.006000 yes
5d_25C 7d_25C 0.927162 no
5d_25C 7d_15C 0.512388 no
5d_25C 7d_30C 0.685715 no
5d_25C 10d_25C 0.124534 no
7d_25C 7d_15C 0.609797 no
7d_25C 7d_30C 0.783744 no
7d_25C 10d_25C 0.178456 no
7d_15C 7d_30C 0.849847 no
7d_15C 10d_25C 0.530448 no
7d_30C 10d_25C 0.349606 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2608.t1
MLKPFQIRNLRVSQPGQSADSRTPAGVVQISATDYDDLASNHPRARLTYMDDDDDDETITVGSAFELSQRLEEPL
DTNTQLESVELSPQDIPMHIFDIRRSNSVTELWKRFEDNVPKQGMADEKDETQATSKTIVLEEQHEVPAPHITTS
PSVSRDQPRSLMEAFEAELADILNDAEYSKSRVPEPDSPPTGSSTNTDSGRSPHPVEILAAQVLDHLINGATMVQ
SEWRSKIPELQRQVHNAQKQFEAAQRTLPQNVQASLRTLLATVEAHLRTAYNNLPDGGRQMAEDAFQAGRPVAEN
AADGFRMMASELNEVGRTLFAAFESEFGRATPTASASTPASEMPNSRATGPFFNSSSSNESAAPSTLYQNSGAHS
SSTARNEKSTVDSGHPHSSNTAQAGVPPIQSCHGQPASPHSNHWAPPAWPAPSWNPFQTYNAPPPPCPPPPASLP
NFTYWPQRPPAPPPLPTFNSPLKATQTSNVMSGELKTDSATKSLFIGNVGFKVTDKMIQDVFAAKGFLVEVDLPL
DTASKTHAGFGYVHFPSDYPAFAAMEALQGAVIDGHSINLEPMYRSPIEGVRPVQISPNASTTTHDTQTDSAPDE
TSDITDAPSERNSTTSGPFAYPLAIKLQNSPSKPGKTDNQTGPSALLDSPSDDPAFSARFPSLLPETSAQRNDPL
SDQGVSSYSHTESGFPPVSQWEAQLLSNRQEHRGAEPIPGVLHSQSPNDLEHPEVLSTHGSPLHPTPKAFAGSQP
ASRLEAAGNPSSIVGARRPSDHSKSMQDQIGHSSGAKETVRPVLDVNDPQYAVKLKRRVTEHQTYKPNHWNAAET
GRRNPLGHSASVRRPADTWARLSRRERNGVSSHERIPGSFPVDDTMRVELPSTHDTNVPESDDGTIEQCVSALVD
MGYGAGQEGGRSRMAVYAAMANGVLTDAIDMIEEERQIYERRPSQ*
Coding >Pro_DTO377G3_2|g2608.t1
ATGTTGAAACCCTTCCAAATCAGAAACCTTCGGGTATCCCAACCCGGGCAGTCTGCGGATTCTCGTACTCCTGCA
GGAGTTGTCCAAATCTCTGCTACAGATTACGATGATTTGGCGTCAAACCATCCCCGCGCAAGGTTGACTTACATG
GATGACGATGATGATGACGAAACAATCACCGTTGGATCCGCTTTCGAGCTATCTCAACGCCTTGAGGAGCCCCTA
GACACTAACACACAGCTTGAATCCGTCGAACTCTCTCCCCAAGATATCCCCATGCACATCTTTGATATTCGTCGA
TCAAACTCCGTGACCGAGTTGTGGAAGCGATTTGAAGATAACGTTCCAAAACAAGGCATGGCTGATGAAAAGGAC
GAGACGCAAGCTACTTCTAAAACTATTGTTCTCGAGGAGCAACATGAAGTCCCAGCTCCTCATATCACGACCTCG
CCGTCGGTCTCTAGGGACCAGCCTCGATCTCTCATGGAAGCATTCGAAGCTGAGCTAGCAGACATTCTCAATGAC
GCTGAGTACTCGAAGAGTCGAGTACCTGAACCTGACTCGCCACCGACTGGGTCATCAACCAACACAGACTCAGGG
CGATCCCCTCATCCCGTTGAGATTTTGGCAGCACAGGTTCTAGACCACCTGATCAACGGAGCCACTATGGTACAA
TCTGAATGGAGATCAAAAATACCCGAGCTACAGCGACAAGTACACAATGCTCAGAAACAATTTGAGGCTGCACAG
AGAACTCTGCCTCAGAATGTGCAAGCCTCATTGCGGACACTACTCGCCACTGTTGAGGCTCACCTAAGAACCGCT
TATAATAATCTTCCAGATGGCGGAAGGCAAATGGCAGAAGATGCCTTCCAGGCAGGAAGGCCTGTTGCTGAGAAT
GCTGCTGATGGTTTTCGTATGATGGCCTCCGAACTCAACGAAGTCGGAAGAACATTATTTGCCGCATTTGAAAGC
GAGTTTGGGCGCGCTACACCAACAGCCTCTGCGTCGACCCCGGCTTCTGAGATGCCAAATTCTAGAGCAACCGGG
CCGTTCTTTAACTCTAGTTCAAGCAATGAATCTGCGGCTCCGAGCACTTTGTACCAGAACTCAGGCGCACATTCT
TCAAGCACAGCCAGAAACGAAAAGTCAACGGTAGACTCAGGTCATCCGCACTCATCTAATACTGCACAAGCAGGA
GTACCCCCTATCCAAAGTTGTCATGGTCAACCCGCATCCCCTCACTCAAATCACTGGGCACCTCCCGCATGGCCT
GCTCCGTCCTGGAATCCATTCCAAACTTATAACGCACCCCCGCCTCCGTGTCCTCCACCACCGGCATCGCTGCCG
AACTTCACTTACTGGCCTCAAAGGCCACCTGCGCCTCCGCCTCTTCCTACGTTCAATTCCCCGTTGAAAGCTACA
CAGACATCGAACGTCATGTCTGGAGAATTGAAAACCGATTCAGCAACTAAGTCCTTGTTTATTGGGAATGTTGGT
TTCAAGGTTACCGATAAGATGATACAGGATGTGTTTGCTGCCAAGGGATTCCTTGTCGAGGTGGATCTCCCATTA
GATACCGCATCAAAAACACATGCAGGCTTCGGCTACGTTCATTTCCCCTCGGATTATCCGGCTTTTGCTGCAATG
GAAGCATTGCAAGGTGCTGTCATTGATGGTCACTCGATAAACCTTGAGCCTATGTATCGTTCCCCCATCGAAGGT
GTGCGTCCGGTGCAGATTTCACCCAATGCCAGTACAACCACACACGACACTCAGACAGACAGCGCCCCGGATGAG
ACGAGCGATATAACCGATGCTCCCTCTGAGCGAAACAGTACCACATCGGGGCCCTTTGCCTACCCGCTTGCTATC
AAGCTACAAAATAGTCCATCCAAGCCTGGCAAAACGGATAATCAGACGGGACCGTCCGCACTACTTGATTCCCCA
AGTGACGATCCTGCATTTAGCGCACGTTTCCCCTCGCTTCTACCCGAGACGAGTGCACAGCGTAACGATCCATTG
AGTGATCAAGGTGTTTCCTCATATTCGCACACGGAGTCTGGTTTCCCACCTGTGTCTCAATGGGAAGCCCAACTT
CTTTCAAATCGGCAGGAACACCGCGGAGCAGAACCTATACCTGGTGTTTTGCATAGTCAATCACCAAACGACCTA
GAACACCCTGAGGTACTCTCAACTCACGGTTCACCCTTGCATCCTACCCCGAAGGCATTTGCTGGATCTCAACCA
GCTTCTCGTCTAGAGGCAGCCGGCAATCCGTCATCGATCGTTGGTGCTAGACGACCTTCCGACCATAGTAAATCA
ATGCAAGATCAAATCGGTCATTCTTCCGGTGCCAAGGAGACTGTGCGCCCAGTGCTAGATGTCAATGACCCCCAG
TATGCGGTCAAACTGAAGCGTCGAGTTACTGAGCACCAAACTTATAAACCAAATCATTGGAACGCTGCGGAGACT
GGCCGTCGTAATCCCCTCGGTCATTCCGCAAGCGTGCGTCGTCCTGCAGACACATGGGCTCGGCTGTCTAGGCGA
GAACGAAATGGTGTATCTTCTCACGAGCGAATCCCCGGAAGCTTCCCAGTGGACGATACAATGAGGGTCGAACTC
CCCAGCACTCATGATACCAATGTTCCTGAGTCGGATGACGGGACAATCGAACAATGTGTCTCTGCTCTTGTCGAC
ATGGGCTACGGGGCTGGACAGGAGGGCGGACGGTCGAGGATGGCTGTGTATGCAGCCATGGCAAATGGTGTCCTC
ACGGATGCGATTGATATGATTGAAGAGGAAAGACAGATCTATGAACGGCGGCCTTCGCAGTGA
Transcript >Pro_DTO377G3_2|g2608.t1
ATGTTGAAACCCTTCCAAATCAGAAACCTTCGGGTATCCCAACCCGGGCAGTCTGCGGATTCTCGTACTCCTGCA
GGAGTTGTCCAAATCTCTGCTACAGATTACGATGATTTGGCGTCAAACCATCCCCGCGCAAGGTTGACTTACATG
GATGACGATGATGATGACGAAACAATCACCGTTGGATCCGCTTTCGAGCTATCTCAACGCCTTGAGGAGCCCCTA
GACACTAACACACAGCTTGAATCCGTCGAACTCTCTCCCCAAGATATCCCCATGCACATCTTTGATATTCGTCGA
TCAAACTCCGTGACCGAGTTGTGGAAGCGATTTGAAGATAACGTTCCAAAACAAGGCATGGCTGATGAAAAGGAC
GAGACGCAAGCTACTTCTAAAACTATTGTTCTCGAGGAGCAACATGAAGTCCCAGCTCCTCATATCACGACCTCG
CCGTCGGTCTCTAGGGACCAGCCTCGATCTCTCATGGAAGCATTCGAAGCTGAGCTAGCAGACATTCTCAATGAC
GCTGAGTACTCGAAGAGTCGAGTACCTGAACCTGACTCGCCACCGACTGGGTCATCAACCAACACAGACTCAGGG
CGATCCCCTCATCCCGTTGAGATTTTGGCAGCACAGGTTCTAGACCACCTGATCAACGGAGCCACTATGGTACAA
TCTGAATGGAGATCAAAAATACCCGAGCTACAGCGACAAGTACACAATGCTCAGAAACAATTTGAGGCTGCACAG
AGAACTCTGCCTCAGAATGTGCAAGCCTCATTGCGGACACTACTCGCCACTGTTGAGGCTCACCTAAGAACCGCT
TATAATAATCTTCCAGATGGCGGAAGGCAAATGGCAGAAGATGCCTTCCAGGCAGGAAGGCCTGTTGCTGAGAAT
GCTGCTGATGGTTTTCGTATGATGGCCTCCGAACTCAACGAAGTCGGAAGAACATTATTTGCCGCATTTGAAAGC
GAGTTTGGGCGCGCTACACCAACAGCCTCTGCGTCGACCCCGGCTTCTGAGATGCCAAATTCTAGAGCAACCGGG
CCGTTCTTTAACTCTAGTTCAAGCAATGAATCTGCGGCTCCGAGCACTTTGTACCAGAACTCAGGCGCACATTCT
TCAAGCACAGCCAGAAACGAAAAGTCAACGGTAGACTCAGGTCATCCGCACTCATCTAATACTGCACAAGCAGGA
GTACCCCCTATCCAAAGTTGTCATGGTCAACCCGCATCCCCTCACTCAAATCACTGGGCACCTCCCGCATGGCCT
GCTCCGTCCTGGAATCCATTCCAAACTTATAACGCACCCCCGCCTCCGTGTCCTCCACCACCGGCATCGCTGCCG
AACTTCACTTACTGGCCTCAAAGGCCACCTGCGCCTCCGCCTCTTCCTACGTTCAATTCCCCGTTGAAAGCTACA
CAGACATCGAACGTCATGTCTGGAGAATTGAAAACCGATTCAGCAACTAAGTCCTTGTTTATTGGGAATGTTGGT
TTCAAGGTTACCGATAAGATGATACAGGATGTGTTTGCTGCCAAGGGATTCCTTGTCGAGGTGGATCTCCCATTA
GATACCGCATCAAAAACACATGCAGGCTTCGGCTACGTTCATTTCCCCTCGGATTATCCGGCTTTTGCTGCAATG
GAAGCATTGCAAGGTGCTGTCATTGATGGTCACTCGATAAACCTTGAGCCTATGTATCGTTCCCCCATCGAAGGT
GTGCGTCCGGTGCAGATTTCACCCAATGCCAGTACAACCACACACGACACTCAGACAGACAGCGCCCCGGATGAG
ACGAGCGATATAACCGATGCTCCCTCTGAGCGAAACAGTACCACATCGGGGCCCTTTGCCTACCCGCTTGCTATC
AAGCTACAAAATAGTCCATCCAAGCCTGGCAAAACGGATAATCAGACGGGACCGTCCGCACTACTTGATTCCCCA
AGTGACGATCCTGCATTTAGCGCACGTTTCCCCTCGCTTCTACCCGAGACGAGTGCACAGCGTAACGATCCATTG
AGTGATCAAGGTGTTTCCTCATATTCGCACACGGAGTCTGGTTTCCCACCTGTGTCTCAATGGGAAGCCCAACTT
CTTTCAAATCGGCAGGAACACCGCGGAGCAGAACCTATACCTGGTGTTTTGCATAGTCAATCACCAAACGACCTA
GAACACCCTGAGGTACTCTCAACTCACGGTTCACCCTTGCATCCTACCCCGAAGGCATTTGCTGGATCTCAACCA
GCTTCTCGTCTAGAGGCAGCCGGCAATCCGTCATCGATCGTTGGTGCTAGACGACCTTCCGACCATAGTAAATCA
ATGCAAGATCAAATCGGTCATTCTTCCGGTGCCAAGGAGACTGTGCGCCCAGTGCTAGATGTCAATGACCCCCAG
TATGCGGTCAAACTGAAGCGTCGAGTTACTGAGCACCAAACTTATAAACCAAATCATTGGAACGCTGCGGAGACT
GGCCGTCGTAATCCCCTCGGTCATTCCGCAAGCGTGCGTCGTCCTGCAGACACATGGGCTCGGCTGTCTAGGCGA
GAACGAAATGGTGTATCTTCTCACGAGCGAATCCCCGGAAGCTTCCCAGTGGACGATACAATGAGGGTCGAACTC
CCCAGCACTCATGATACCAATGTTCCTGAGTCGGATGACGGGACAATCGAACAATGTGTCTCTGCTCTTGTCGAC
ATGGGCTACGGGGCTGGACAGGAGGGCGGACGGTCGAGGATGGCTGTGTATGCAGCCATGGCAAATGGTGTCCTC
ACGGATGCGATTGATATGATTGAAGAGGAAAGACAGATCTATGAACGGCGGCCTTCGCAGTGA
Gene >Pro_DTO377G3_2|g2608.t1
ATGTTGAAACCCTTCCAAATCAGAAACCTTCGGGTATCCCAACCCGGGCAGTCTGCGGATTCTCGTACTCCTGCA
GGAGTTGTCCAAATCTCTGCTACAGATTACGATGATTTGGCGTCAAACCATCCCCGCGCAAGGTTGACTTACATG
GATGACGATGATGATGACGAAACAATCACCGTAAGTTCAGCACAGTGTTTATCGATCATCGAAATCTCACTCTTT
TCCTTAGGTTGGATCCGCTTTCGAGCTATCTCAACGCCTTGAGGAGCCCCTAGACACTAACACACAGCTTGAATC
CGTCGAACTCTCTCCCCAAGATATCCCCATGCACATCTTTGATATTCGTCGATCAAACTCCGTGACCGAGTTGTG
GAAGCGATTTGAAGATAACGTTCCAAAACAAGGCATGGCTGATGAAAAGGACGAGACGCAAGCTACTTCTAAAAC
TATTGTTCTCGAGGAGCAACATGAAGTCCCAGCTCCTCATATCACGACCTCGCCGTCGGTCTCTAGGGACCAGCC
TCGATCTCTCATGGAAGCATTCGAAGCTGAGCTAGCAGACATTCTCAATGACGCTGAGTACTCGAAGAGTCGAGT
ACCTGAACCTGACTCGCCACCGACTGGGTCATCAACCAACACAGACTCAGGGCGATCCCCTCATCCCGTTGAGAT
TTTGGCAGCACAGGTTCTAGACCACCTGATCAACGGAGCCACTATGGTACAATCTGAATGGAGATCAAAAATACC
CGAGCTACAGCGACAAGTACACAATGCTCAGAAACAATTTGAGGCTGCACAGAGAACTCTGCCTCAGAATGTGCA
AGCCTCATTGCGGACACTACTCGCCACTGTTGAGGCTCACCTAAGAACCGCTTATAATAATCTTCCAGATGGCGG
AAGGCAAATGGCAGAAGATGCCTTCCAGGCAGGAAGGCCTGTTGCTGAGAATGCTGCTGATGGTTTTCGTATGAT
GGCCTCCGAACTCAACGAAGTCGGAAGAACATTATTTGCCGCATTTGAAAGCGAGTTTGGGCGCGCTACACCAAC
AGCCTCTGCGTCGACCCCGGCTTCTGAGATGCCAAATTCTAGAGCAACCGGGCCGTTCTTTAACTCTAGTTCAAG
CAATGAATCTGCGGCTCCGAGCACTTTGTACCAGAACTCAGGCGCACATTCTTCAAGCACAGCCAGAAACGAAAA
GTCAACGGTAGACTCAGGTCATCCGCACTCATCTAATACTGCACAAGCAGGAGTACCCCCTATCCAAAGTTGTCA
TGGTCAACCCGCATCCCCTCACTCAAATCACTGGGCACCTCCCGCATGGCCTGCTCCGTCCTGGAATCCATTCCA
AACTTATAACGCACCCCCGCCTCCGTGTCCTCCACCACCGGCATCGCTGCCGAACTTCACTTACTGGCCTCAAAG
GCCACCTGCGCCTCCGCCTCTTCCTACGTTCAATTCCCCGTTGAAAGCTACACAGACATCGAACGTCATGTCTGG
AGAATTGAAAACCGATTCAGCAACTAAGTCCTTGTTTATTGGGAATGTTGGTTTCAAGGTTACCGATAAGATGAT
ACAGGATGTGTTTGCTGCCAAGGGATTCCTTGTCGAGGTGGATCTCCCATTAGATACCGCATCAAAAACACATGC
AGGCTTCGGCTACGTTCATTTCCCCTCGGATTATCCGGCTTTTGCTGCAATGGAAGCATTGCAAGGTGCTGTCAT
TGATGGTCACTCGATAAACCTTGAGCCTATGTATCGTTCCCCCATCGAAGGTGTGCGTCCGGTGCAGATTTCACC
CAATGCCAGTACAACCACACACGACACTCAGACAGACAGCGCCCCGGATGAGACGAGCGATATAACCGATGCTCC
CTCTGAGCGAAACAGTACCACATCGGGGCCCTTTGCCTACCCGCTTGCTATCAAGCTACAAAATAGTCCATCCAA
GCCTGGCAAAACGGATAATCAGACGGGACCGTCCGCACTACTTGATTCCCCAAGTGACGATCCTGCATTTAGCGC
ACGTTTCCCCTCGCTTCTACCCGAGACGAGTGCACAGCGTAACGATCCATTGAGTGATCAAGGTGTTTCCTCATA
TTCGCACACGGAGTCTGGTTTCCCACCTGTGTCTCAATGGGAAGCCCAACTTCTTTCAAATCGGCAGGAACACCG
CGGAGCAGAACCTATACCTGGTGTTTTGCATAGTCAATCACCAAACGACCTAGAACACCCTGAGGTACTCTCAAC
TCACGGTTCACCCTTGCATCCTACCCCGAAGGCATTTGCTGGATCTCAACCAGCTTCTCGTCTAGAGGCAGCCGG
CAATCCGTCATCGATCGTTGGTGCTAGACGACCTTCCGACCATAGTAAATCAATGCAAGATCAAATCGGTCATTC
TTCCGGTGCCAAGGAGACTGTGCGCCCAGTGCTAGATGTCAATGACCCCCAGTATGCGGTCAAACTGAAGCGTCG
AGTTACTGAGCACCAAACTTATAAACCAAATCATTGGAACGCTGCGGAGACTGGCCGTCGTAATCCCCTCGGTCA
TTCCGCAAGCGTGCGTCGTCCTGCAGACACATGGGCTCGGCTGTCTAGGCGAGAACGAAATGGTGTATCTTCTCA
CGAGCGAATCCCCGGAAGCTTCCCAGTGGACGATACAATGAGGGTCGAACTCCCCAGCACTCATGATACCAATGT
TCCTGAGTCGGATGACGGGACAATCGAACAATGTGTCTCTGCTCTTGTCGACATGGGCTACGGGGCTGGACAGGA
GGGCGGACGGTCGAGGATGGCTGTGTATGCAGCCATGGCAAATGGTGTCCTCACGGATGCGATTGATATGATTGA
AGAGGAAAGACAGATCTATGAACGGCGGCCTTCGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail