Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2598.t1
Gene name
Locationscaffold_03:440318..443633
Strand+
Gene length (bp)3315
Transcript length (bp)2856
Coding sequence length (bp)2856
Protein length (aa) 952

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10277 Frag1 Frag1/DRAM/Sfk1 family 4.9E-42 17 223

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 74 96 22
3 108 127 19
4 137 156 19
5 169 186 17
6 201 220 19
7 276 298 22
8 302 324 22
9 355 372 17
10 387 404 17
11 456 475 19
12 495 517 22
13 524 543 19
14 547 569 22
15 576 598 22
16 611 630 19
17 651 670 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2598.t1
MAPRYKDGDAVVAINGKWVAWTHTVFAYAAFISALIVGIALHYHKIVQNEHYGYPIEWFPSVSATIGDRYPERSF
FQVFIAITSGPRFALVFLWYILTSRPNSTLPKLVAGVGIFRTLTCGGWTYVTSTDDHDWHDIFMISYLVATLPWT
LGCLALSPNNRRAVKYRKILASLFFGTLVPLIYYFIQHKVHKVPGAYTKYAFFEWSLILFDVGFDAVTALDFECF
ELVVRDVKGVSRGQLETTADSVLEKEKGKPVGNTFGEGFFWTEIIDAAADVYNGFVFWTIVTGLPVLVWYFPLWH
MGISGYEVAIVCCASPLFYVIPSLRYAAVKNLRLLHLVSLVGLLGYKFQDPANRLFVTGFALSTTCAAWTASFFS
ERHNAPRLEARIMAWGIGLVLSVVAKFACKTNNPLWPIVHAENGGWNKIGIFIALFAVLRSQRGSNTSGGDYLPA
GGKKGSSILAGVGFGGLMFTIVSLLTDSSTMISWVWDGYPVRGPIAAPHGALTIFAMGAGLVYGIFHPRIAGSWT
AYGVGSIGAALLTCYHHWTGFYGALILAFYTMAVAPVLIVSSVAHSPASTFGIGFLVYVVLLLFHVWVVAYAFVP
GGPFLREHTDWLMTTTMLSIGAGVFSAATSNSTRSRKPHKPVNPNSRRQRSYYIYVLAVLQLLSVSIAYLRFPTN
DYTPYHKEDKVVTAGIWTVHFGLDNNMWSAERRMRDVIGELELDVIGFLESDNQRIIMGNKDVTQFIAEDLGYYT
DFGPGPNKHTWGSALLSKFPIVNSTHHLLPSPVGELAPAIHATLDMYGEMVDIVVFHSGQEEDPEDRRLQSEYLS
KLMGDSPRPLILLSYLVTKPLEGNYNTYVSERSQMKDIDPTDWDRWCEYLLFKKLHRTGYARISRDTITDTEIQV
GKFVIGEPEPENEMRIPEEMVPVGRRFPALFRGEGVRGHRYHVFDEPRYWQ*
Coding >Pro_DTO377G3_2|g2598.t1
ATGGCTCCCCGATACAAGGACGGAGATGCCGTGGTCGCCATCAACGGCAAATGGGTTGCATGGACTCACACGGTT
TTCGCATATGCAGCGTTCATCAGCGCGTTGATTGTCGGCATTGCTTTGCACTACCACAAGATCGTCCAGAATGAA
CACTACGGCTACCCTATTGAATGGTTCCCCTCCGTGTCTGCGACCATCGGTGACCGTTATCCCGAGCGGTCCTTT
TTCCAGGTCTTCATTGCTATTACCTCCGGTCCTCGCTTCGCGCTTGTCTTCCTGTGGTACATCCTCACTTCGCGC
CCGAACTCGACCTTACCTAAGTTGGTTGCCGGCGTGGGCATTTTCCGGACATTGACATGTGGTGGTTGGACCTAT
GTTACATCTACCGATGATCACGACTGGCATGACATTTTCATGATCTCGTACTTGGTGGCCACCTTGCCGTGGACC
CTGGGTTGCCTTGCACTCAGCCCGAACAACCGCCGCGCCGTCAAGTACCGCAAAATCTTGGCCAGTTTGTTCTTT
GGAACTTTGGTTCCACTGATTTACTATTTCATTCAGCACAAGGTCCACAAGGTTCCCGGTGCCTACACCAAATAT
GCCTTCTTTGAATGGTCCCTAATCCTGTTCGATGTCGGTTTTGATGCTGTCACAGCTCTTGACTTTGAGTGCTTC
GAACTAGTGGTGAGGGATGTTAAGGGTGTTAGCAGAGGGCAATTGGAAACGACTGCAGATTCTGTCTTGGAGAAA
GAGAAGGGAAAGCCGGTGGGCAACACCTTTGGCGAGGGATTCTTCTGGACCGAGATCATTGATGCCGCCGCGGAT
GTCTACAATGGGTTTGTTTTCTGGACCATCGTGACTGGTCTGCCTGTCCTTGTCTGGTACTTCCCTCTTTGGCAC
ATGGGTATCTCTGGTTACGAGGTTGCCATTGTTTGCTGCGCATCCCCGTTGTTCTACGTCATCCCATCTTTGCGA
TATGCAGCTGTGAAGAACCTCCGCCTTCTTCACCTGGTTTCGCTCGTTGGTCTTCTCGGATATAAGTTCCAGGAT
CCTGCCAACCGCCTCTTTGTGACTGGATTCGCTCTTTCTACTACGTGTGCAGCATGGACCGCCAGCTTCTTTTCC
GAACGGCACAACGCTCCTCGTCTCGAGGCCCGTATCATGGCTTGGGGAATCGGTCTGGTTTTGTCTGTAGTTGCC
AAGTTTGCATGCAAGACCAACAACCCCCTTTGGCCAATTGTTCACGCCGAGAATGGTGGCTGGAATAAAATTGGA
ATCTTCATTGCTTTGTTCGCGGTTTTGAGGTCCCAGAGAGGTTCAAACACGAGCGGCGGTGATTACTTGCCAGCA
GGTGGCAAGAAGGGCTCGTCCATTCTTGCTGGTGTTGGATTTGGCGGTCTGATGTTCACCATTGTGTCGCTTTTG
ACTGATTCCAGTACCATGATCTCATGGGTCTGGGACGGATACCCAGTGCGCGGACCGATCGCAGCTCCTCACGGT
GCTTTGACGATCTTCGCAATGGGGGCTGGCCTTGTGTACGGCATTTTCCATCCCAGAATCGCTGGAAGCTGGACT
GCCTACGGTGTCGGTTCCATTGGTGCTGCTCTTCTTACTTGCTACCACCACTGGACTGGATTCTACGGTGCCCTC
ATTCTTGCGTTCTATACCATGGCCGTTGCCCCGGTTCTGATTGTATCCAGCGTTGCTCACTCTCCTGCGAGCACT
TTCGGCATCGGCTTCCTTGTTTATGTGGTTCTTTTGCTCTTCCACGTTTGGGTTGTCGCCTATGCCTTCGTTCCA
GGCGGTCCATTCCTTCGTGAGCACACTGACTGGCTCATGACCACTACAATGCTGTCCATTGGTGCGGGTGTTTTC
TCTGCGGCGACCTCGAACTCTACTCGCTCCCGCAAGCCTCACAAGCCTGTCAACCCCAATAGCAGGAGACAGCGA
TCGTACTATATCTACGTTCTTGCTGTGCTGCAACTGCTTTCCGTGTCTATTGCCTACCTCCGCTTCCCGACCAAT
GACTACACACCTTATCACAAGGAAGACAAGGTTGTGACTGCTGGTATCTGGACTGTCCACTTCGGCCTCGACAAC
AACATGTGGTCCGCTGAGCGGCGCATGCGCGATGTCATCGGTGAGCTTGAGCTGGATGTCATTGGTTTCCTCGAA
TCCGACAATCAGCGTATCATCATGGGCAACAAGGACGTTACTCAGTTCATCGCTGAGGACCTTGGCTACTACACT
GACTTCGGCCCCGGTCCAAACAAGCACACCTGGGGCTCTGCCTTGCTGTCTAAATTCCCCATTGTCAACTCTACG
CACCACCTTCTCCCCTCGCCTGTGGGTGAGCTGGCACCTGCAATCCACGCCACACTCGACATGTACGGCGAGATG
GTTGATATTGTTGTGTTCCACTCCGGACAGGAAGAAGACCCTGAGGACCGCCGCTTGCAGAGCGAGTATCTGTCG
AAGTTGATGGGTGATTCCCCACGTCCCCTGATCCTATTAAGTTACCTCGTCACCAAGCCGCTCGAGGGCAACTAC
AACACCTATGTGAGCGAGCGCAGCCAAATGAAGGATATTGACCCTACCGACTGGGATAGATGGTGCGAGTACCTT
CTTTTCAAGAAGCTGCATCGCACTGGCTACGCCAGAATTAGTCGTGATACCATCACGGATACGGAGATCCAGGTT
GGAAAGTTCGTCATCGGCGAGCCCGAACCCGAAAATGAGATGCGTATCCCAGAGGAGATGGTCCCCGTTGGCCGC
CGCTTCCCTGCCTTGTTCCGCGGCGAGGGAGTTCGCGGACACCGCTACCATGTTTTCGATGAACCCAGGTACTGG
CAATAG
Transcript >Pro_DTO377G3_2|g2598.t1
ATGGCTCCCCGATACAAGGACGGAGATGCCGTGGTCGCCATCAACGGCAAATGGGTTGCATGGACTCACACGGTT
TTCGCATATGCAGCGTTCATCAGCGCGTTGATTGTCGGCATTGCTTTGCACTACCACAAGATCGTCCAGAATGAA
CACTACGGCTACCCTATTGAATGGTTCCCCTCCGTGTCTGCGACCATCGGTGACCGTTATCCCGAGCGGTCCTTT
TTCCAGGTCTTCATTGCTATTACCTCCGGTCCTCGCTTCGCGCTTGTCTTCCTGTGGTACATCCTCACTTCGCGC
CCGAACTCGACCTTACCTAAGTTGGTTGCCGGCGTGGGCATTTTCCGGACATTGACATGTGGTGGTTGGACCTAT
GTTACATCTACCGATGATCACGACTGGCATGACATTTTCATGATCTCGTACTTGGTGGCCACCTTGCCGTGGACC
CTGGGTTGCCTTGCACTCAGCCCGAACAACCGCCGCGCCGTCAAGTACCGCAAAATCTTGGCCAGTTTGTTCTTT
GGAACTTTGGTTCCACTGATTTACTATTTCATTCAGCACAAGGTCCACAAGGTTCCCGGTGCCTACACCAAATAT
GCCTTCTTTGAATGGTCCCTAATCCTGTTCGATGTCGGTTTTGATGCTGTCACAGCTCTTGACTTTGAGTGCTTC
GAACTAGTGGTGAGGGATGTTAAGGGTGTTAGCAGAGGGCAATTGGAAACGACTGCAGATTCTGTCTTGGAGAAA
GAGAAGGGAAAGCCGGTGGGCAACACCTTTGGCGAGGGATTCTTCTGGACCGAGATCATTGATGCCGCCGCGGAT
GTCTACAATGGGTTTGTTTTCTGGACCATCGTGACTGGTCTGCCTGTCCTTGTCTGGTACTTCCCTCTTTGGCAC
ATGGGTATCTCTGGTTACGAGGTTGCCATTGTTTGCTGCGCATCCCCGTTGTTCTACGTCATCCCATCTTTGCGA
TATGCAGCTGTGAAGAACCTCCGCCTTCTTCACCTGGTTTCGCTCGTTGGTCTTCTCGGATATAAGTTCCAGGAT
CCTGCCAACCGCCTCTTTGTGACTGGATTCGCTCTTTCTACTACGTGTGCAGCATGGACCGCCAGCTTCTTTTCC
GAACGGCACAACGCTCCTCGTCTCGAGGCCCGTATCATGGCTTGGGGAATCGGTCTGGTTTTGTCTGTAGTTGCC
AAGTTTGCATGCAAGACCAACAACCCCCTTTGGCCAATTGTTCACGCCGAGAATGGTGGCTGGAATAAAATTGGA
ATCTTCATTGCTTTGTTCGCGGTTTTGAGGTCCCAGAGAGGTTCAAACACGAGCGGCGGTGATTACTTGCCAGCA
GGTGGCAAGAAGGGCTCGTCCATTCTTGCTGGTGTTGGATTTGGCGGTCTGATGTTCACCATTGTGTCGCTTTTG
ACTGATTCCAGTACCATGATCTCATGGGTCTGGGACGGATACCCAGTGCGCGGACCGATCGCAGCTCCTCACGGT
GCTTTGACGATCTTCGCAATGGGGGCTGGCCTTGTGTACGGCATTTTCCATCCCAGAATCGCTGGAAGCTGGACT
GCCTACGGTGTCGGTTCCATTGGTGCTGCTCTTCTTACTTGCTACCACCACTGGACTGGATTCTACGGTGCCCTC
ATTCTTGCGTTCTATACCATGGCCGTTGCCCCGGTTCTGATTGTATCCAGCGTTGCTCACTCTCCTGCGAGCACT
TTCGGCATCGGCTTCCTTGTTTATGTGGTTCTTTTGCTCTTCCACGTTTGGGTTGTCGCCTATGCCTTCGTTCCA
GGCGGTCCATTCCTTCGTGAGCACACTGACTGGCTCATGACCACTACAATGCTGTCCATTGGTGCGGGTGTTTTC
TCTGCGGCGACCTCGAACTCTACTCGCTCCCGCAAGCCTCACAAGCCTGTCAACCCCAATAGCAGGAGACAGCGA
TCGTACTATATCTACGTTCTTGCTGTGCTGCAACTGCTTTCCGTGTCTATTGCCTACCTCCGCTTCCCGACCAAT
GACTACACACCTTATCACAAGGAAGACAAGGTTGTGACTGCTGGTATCTGGACTGTCCACTTCGGCCTCGACAAC
AACATGTGGTCCGCTGAGCGGCGCATGCGCGATGTCATCGGTGAGCTTGAGCTGGATGTCATTGGTTTCCTCGAA
TCCGACAATCAGCGTATCATCATGGGCAACAAGGACGTTACTCAGTTCATCGCTGAGGACCTTGGCTACTACACT
GACTTCGGCCCCGGTCCAAACAAGCACACCTGGGGCTCTGCCTTGCTGTCTAAATTCCCCATTGTCAACTCTACG
CACCACCTTCTCCCCTCGCCTGTGGGTGAGCTGGCACCTGCAATCCACGCCACACTCGACATGTACGGCGAGATG
GTTGATATTGTTGTGTTCCACTCCGGACAGGAAGAAGACCCTGAGGACCGCCGCTTGCAGAGCGAGTATCTGTCG
AAGTTGATGGGTGATTCCCCACGTCCCCTGATCCTATTAAGTTACCTCGTCACCAAGCCGCTCGAGGGCAACTAC
AACACCTATGTGAGCGAGCGCAGCCAAATGAAGGATATTGACCCTACCGACTGGGATAGATGGTGCGAGTACCTT
CTTTTCAAGAAGCTGCATCGCACTGGCTACGCCAGAATTAGTCGTGATACCATCACGGATACGGAGATCCAGGTT
GGAAAGTTCGTCATCGGCGAGCCCGAACCCGAAAATGAGATGCGTATCCCAGAGGAGATGGTCCCCGTTGGCCGC
CGCTTCCCTGCCTTGTTCCGCGGCGAGGGAGTTCGCGGACACCGCTACCATGTTTTCGATGAACCCAGGTACTGG
CAATAG
Gene >Pro_DTO377G3_2|g2598.t1
ATGGCTCCCCGATACAAGGACGGAGATGCCGTGGTCGCCGTAAGTGCTGAAGCGCCATCTGATGCGGATCTAGAA
ACGCCACTGACTTGATATCTTTGCAGATCAACGGCAAATGGGTTGCATGGACTCACACGGTTTTCGCATATGCAG
CGTTCATCAGCGCGTTGATTGTCGGCATTGCTTTGCACTACCACAAGATCGTCCAGAATGAACACTACGGCTACC
CTATTGAATGGTTCCCCTCCGTGTCTGCGACCATCGGTGACCGTTATCCCGAGCGGTCCTTTTTCCAGGTCTTCA
TTGCTATTACCTCCGGTCCTCGCTTCGCGCTTGTCTTCCTGTGGTACATCCTCACTTCGCGCCCGAACTCGACCT
TACCTAAGTTGGTTGCCGGCGTGGGCATTTTCCGGACATTGACATGTGGTGGTTGGACCTATGTTACATCTACCG
ATGATCACGACTGGCATGACATTTTCATGATCTCGTACTTGGTGGCCACCTTGCCGTGGACCCTGGGTTGCCTTG
CACTCAGCCCGAACAACCGCCGCGCCGTCAAGTACCGCAAAATCTTGGCCAGTTTGTTCTTTGGAACTTTGGTTC
CACTGATTTACTATTTCATTCAGCACAAGGTCCACAAGGTTCCCGGTGGTGAGTACTTGTCTTCGTGAGCATTCA
GCTGGGGTTTATCGCATGCTAATCAGTCAAACCTTTAGCCTACACCAAATATGCCTTCTTTGAATGGTCCCTAAT
CCTGTTCGATGTCGGTTTTGATGCTGTCACAGCTCTTGACTTTGAGTGCTTCGAACTAGTGGTGAGGGATGTTAA
GGGTGTTAGCAGAGGGTATGTACCGTGGCTTCCAAAATGACACTGCCCGCATCAAATGTATAGTGCCAAAGGCTA
TATTGGTTTTGAAAAAAAAAGACATTGTCTAAGTTTGTGTTCATTAGGCAATTGGAAACGACTGCAGATTCTGTC
TTGGAGAAAGAGTGTGTACAATCCCATAACCAACTACAACCATCCCGGAAATTAACCACATACGTAGGAAGGGAA
AGCCGGTGGGCAACACCTTTGGCGAGGGATTCTTCTGGACCGAGATCATTGATGCCGCCGCGGATGTCTACAATG
GGGTAAATTATACCGGTCGATCATTGGTCTTTTGTGTTACTGACAATGGACTGTAGTTTGTTTTCTGGACCATCG
TGACTGGTCTGCCTGTCCTTGTCTGGTGTAAGTGACACATATTCCTCTCTATATGGACTTGTCTGATATTGATAG
ACTTCCCTCTTTGGCACATGGGTATCTCTGGTTACGAGGTTGCCATTGTTTGCTGCGCATCCCCGTTGTTCTACG
TCATCCCATCTTTGCGATATGCAGCTGTGAAGAACCTCCGCCTTCTTCACCTGGTTTCGCTCGTTGGTCTTCTCG
GATATAAGTTCCAGGATCCTGCCAACCGCCTCTTTGTGACTGGATTCGCTCTTTCTACTACGTGTGCAGCATGGA
CCGCCAGCTTCTTTTCCGAACGGCACAACGCTCCTCGTCTCGAGGCCCGTATCATGGCTTGGGGAATCGGTCTGG
TTTTGTCTGTAGTTGCCAAGTTTGCATGCAAGACCAACAACCCCCTTTGGCCAATTGTTCACGCCGAGAATGGTG
GCTGGAATAAAATTGGAATCTTCATTGCTTTGTTCGCGGTTTTGAGGTCCCAGAGAGGTTCAAACACGAGCGGCG
GTGATTACTTGCCAGCAGGTGGCAAGAAGGGCTCGTCCATTCTTGCTGGTGTTGGATTTGGCGGTCTGATGTTCA
CCATTGTGTCGCTTTTGACTGATTCCAGTACCATGATCTCATGGGTCTGGGACGGATACCCAGTGCGCGGACCGA
TCGCAGCTCCTCACGGTGCTTTGACGATCTTCGCAATGGGGGCTGGCCTTGTGTACGGCATTTTCCATCCCAGAA
TCGCTGGAAGCTGGACTGCCTACGGTGTCGGTTCCATTGGTGCTGCTCTTCTTACTTGCTACCACCACTGGACTG
GATTCTACGGTGCCCTCATTCTTGCGTTCTATACCATGGCCGTTGCCCCGGTTCTGATTGTATCCAGCGTTGCTC
ACTCTCCTGCGAGCACTTTCGGCATCGGCTTCCTTGTTTATGTGGTTCTTTTGCTCTTCCACGTTTGGGTTGTCG
CCTATGCCTTCGTTCCAGGCGGTCCATTCCTTCGTGAGCACACTGACTGGCTCATGACCACTACAATGCTGTCCA
TTGGTGCGGGTGTTTTCTCTGCGGCGACCTCGAACTCTACTCGCTCCCGCAAGCCTCACAAGCCTGTCAACCCCA
ATAGCAGGAGACAGCGATCGTACTATATCTACGTTCTTGCTGTGCTGCAACTGCTTTCCGTGTCTATTGCCTACC
TCCGCTTCCCGACCAATGACTACACACCTTATCACAAGGAAGACAAGGTTGTGACTGCTGGTATCTGGACTGTCC
ACTTCGGCCTCGACAACAACATGTGGTCCGCTGAGCGGCGCATGCGCGATGTCATCGGTGAGCTTGAGCTGGATG
TCATTGGTTTCCTCGAATCCGACAATCAGCGTATCATCATGGGCAACAAGGACGTTACTCAGTTCATCGCTGAGG
ACCTTGGCTACTACACTGACTTCGGCCCCGGTCCAAACAAGCACACCTGGGGCTCTGCCTTGCTGTCTAAATTCC
CCATTGTCAACTCTACGCACCACCTTCTCCCCTCGCCTGTGGGTGAGCTGGCACCTGCAATCCACGCCACACTCG
ACATGTACGGCGAGATGGTTGATATTGTTGTGTTCCACTCCGGACAGGAAGAAGACCCTGAGGACCGCCGCTTGC
AGAGCGAGTATCTGTCGAAGTTGATGGGTGATTCCCCACGTCCCCTGATCCTATTAAGTTACCTCGTCACCAAGC
CGCTCGAGGGCAACTACAACACCTATGTGAGCGAGCGCAGCCAAATGAAGGATATTGACCCTACCGACTGGGATA
GATGGTGCGAGTACCTTCTTTTCAAGAAGCTGCATCGCACTGGCTACGCCAGAATTAGTCGTGATACCATCACGG
ATACGGAGATCCAGGTAAGTGATGTTCTCTCTTTATTTCTTCTCCTACGCGTGCTTAGTTTCTGACTGTTTCGTG
ATCTAGGTTGGAAAGTTCGTCATCGGCGAGCCCGAACCCGAAAATGAGATGCGTATCCCAGAGGAGATGGTCCCC
GTTGGCCGCCGCTTCCCTGCCTTGTTCCGCGGCGAGGGAGTTCGCGGACACCGCTACCATGTTTTCGATGAACCC
AGGTACTGGCAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail