Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2597.t1
Gene name
Locationscaffold_03:438784..440025
Strand-
Gene length (bp)1241
Transcript length (bp)1188
Coding sequence length (bp)1188
Protein length (aa) 396

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08640 U3_assoc_6 U3 small nucleolar RNA-associated protein 6 6.5E-29 12 80

GO

GO Term Description Terminal node
GO:0030515 snoRNA binding Yes
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Yes
GO:0006139 nucleobase-containing compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0030490 maturation of SSU-rRNA No
GO:0071704 organic substance metabolic process No
GO:0034470 ncRNA processing No
GO:1901360 organic cyclic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006396 RNA processing No
GO:0044237 cellular metabolic process No
GO:0006364 rRNA processing No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0003676 nucleic acid binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016072 rRNA metabolic process No
GO:0003723 RNA binding No
GO:0005488 binding No
GO:0016070 RNA metabolic process No
GO:0034660 ncRNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2597.t1
MSAATDKARFFLEKSVPELKEYERKKIFTKDEISSIVRKRSDFEHKLNARGAQPVDFVRYAEYEMNLDVLRKKRV
KRLGIRSAGFNGQRRIFFVLDRATRKFHGDINLWVQYIEYARKQKAHKKLLTIFTDALRLHPTSADLWVYAAKHV
LDDHGDMTQARSYMQRGLRFCKSARAIWIQYAKLELIYIAKLVARQRILGLDEESQKPKAIQEAEIDDTDADMIA
LPSLTAEDINPSTGVDGEVDQVALQNLNSTPALSGAIPLAIFDTATKHFDHDDRFGQEFFDMAWEFGDVPCLRKI
LEHVIETMQANKPSSPRTQICYIKFPTAGIPSTSAEFPRALGTSLARLREYPMGKDLAHQVINWLQPVQATKDLD
PSLQKVIAVTIRNAERAAQE*
Coding >Pro_DTO377G3_2|g2597.t1
ATGTCCGCCGCAACAGATAAGGCTCGATTTTTCCTCGAGAAGTCAGTGCCTGAGCTCAAGGAATATGAGCGCAAG
AAGATTTTCACCAAGGATGAAATCTCCTCAATCGTTAGAAAGCGATCTGATTTTGAACACAAGCTCAACGCGCGC
GGGGCGCAGCCAGTGGACTTTGTGCGCTATGCTGAATACGAAATGAACCTCGATGTGCTGCGAAAGAAGCGGGTG
AAGCGACTTGGAATTCGGTCGGCAGGGTTCAACGGCCAGCGACGCATCTTCTTCGTTCTCGACCGAGCTACACGC
AAGTTCCACGGCGATATCAACCTCTGGGTCCAGTATATCGAATATGCTCGCAAACAAAAGGCACACAAGAAGCTT
CTCACGATTTTCACCGATGCTCTGCGACTACACCCTACCAGCGCCGACTTATGGGTTTATGCCGCTAAGCACGTC
CTCGATGACCACGGAGATATGACACAAGCTCGGAGTTACATGCAGCGCGGTTTACGGTTCTGCAAGAGCGCGAGG
GCAATTTGGATTCAATATGCAAAGCTGGAACTGATTTACATCGCAAAGCTGGTCGCTCGCCAACGGATTCTCGGT
CTTGATGAGGAGAGCCAGAAGCCCAAGGCCATCCAAGAAGCAGAAATTGACGACACTGATGCCGACATGATTGCG
CTCCCATCACTCACAGCCGAGGACATCAACCCGAGCACAGGAGTGGACGGAGAAGTAGACCAGGTTGCGCTGCAA
AACCTGAACTCCACGCCCGCTCTGAGCGGTGCTATCCCGCTCGCCATCTTTGATACCGCCACGAAGCATTTCGAC
CACGATGATCGGTTCGGTCAGGAGTTCTTCGACATGGCTTGGGAATTCGGGGATGTGCCTTGCCTTCGCAAGATT
TTGGAACATGTGATTGAGACGATGCAGGCCAACAAGCCTTCCAGCCCACGGACGCAGATTTGCTACATTAAGTTC
CCGACCGCTGGAATCCCTTCCACTTCGGCCGAATTCCCGCGGGCGCTTGGTACTTCGCTTGCCCGCCTCAGGGAG
TATCCCATGGGCAAGGATCTCGCACACCAAGTGATCAACTGGCTCCAACCCGTCCAGGCAACAAAGGATCTGGAT
CCTTCGTTGCAGAAGGTTATTGCGGTTACCATCCGCAATGCGGAGCGCGCGGCACAGGAGTAG
Transcript >Pro_DTO377G3_2|g2597.t1
ATGTCCGCCGCAACAGATAAGGCTCGATTTTTCCTCGAGAAGTCAGTGCCTGAGCTCAAGGAATATGAGCGCAAG
AAGATTTTCACCAAGGATGAAATCTCCTCAATCGTTAGAAAGCGATCTGATTTTGAACACAAGCTCAACGCGCGC
GGGGCGCAGCCAGTGGACTTTGTGCGCTATGCTGAATACGAAATGAACCTCGATGTGCTGCGAAAGAAGCGGGTG
AAGCGACTTGGAATTCGGTCGGCAGGGTTCAACGGCCAGCGACGCATCTTCTTCGTTCTCGACCGAGCTACACGC
AAGTTCCACGGCGATATCAACCTCTGGGTCCAGTATATCGAATATGCTCGCAAACAAAAGGCACACAAGAAGCTT
CTCACGATTTTCACCGATGCTCTGCGACTACACCCTACCAGCGCCGACTTATGGGTTTATGCCGCTAAGCACGTC
CTCGATGACCACGGAGATATGACACAAGCTCGGAGTTACATGCAGCGCGGTTTACGGTTCTGCAAGAGCGCGAGG
GCAATTTGGATTCAATATGCAAAGCTGGAACTGATTTACATCGCAAAGCTGGTCGCTCGCCAACGGATTCTCGGT
CTTGATGAGGAGAGCCAGAAGCCCAAGGCCATCCAAGAAGCAGAAATTGACGACACTGATGCCGACATGATTGCG
CTCCCATCACTCACAGCCGAGGACATCAACCCGAGCACAGGAGTGGACGGAGAAGTAGACCAGGTTGCGCTGCAA
AACCTGAACTCCACGCCCGCTCTGAGCGGTGCTATCCCGCTCGCCATCTTTGATACCGCCACGAAGCATTTCGAC
CACGATGATCGGTTCGGTCAGGAGTTCTTCGACATGGCTTGGGAATTCGGGGATGTGCCTTGCCTTCGCAAGATT
TTGGAACATGTGATTGAGACGATGCAGGCCAACAAGCCTTCCAGCCCACGGACGCAGATTTGCTACATTAAGTTC
CCGACCGCTGGAATCCCTTCCACTTCGGCCGAATTCCCGCGGGCGCTTGGTACTTCGCTTGCCCGCCTCAGGGAG
TATCCCATGGGCAAGGATCTCGCACACCAAGTGATCAACTGGCTCCAACCCGTCCAGGCAACAAAGGATCTGGAT
CCTTCGTTGCAGAAGGTTATTGCGGTTACCATCCGCAATGCGGAGCGCGCGGCACAGGAGTAG
Gene >Pro_DTO377G3_2|g2597.t1
ATGTCCGCCGCAACAGATAAGGCTCGATTTTTCCTCGAGAAGTCAGTGCCTGAGCTCAAGGAATATGAGCGCAAG
AAGATTTTCACCAAGGTAAGCCTGCGAGGCGGAATTCTTCCATTAGAATAACAGCTAATGATAACTAGGATGAAA
TCTCCTCAATCGTTAGAAAGCGATCTGATTTTGAACACAAGCTCAACGCGCGCGGGGCGCAGCCAGTGGACTTTG
TGCGCTATGCTGAATACGAAATGAACCTCGATGTGCTGCGAAAGAAGCGGGTGAAGCGACTTGGAATTCGGTCGG
CAGGGTTCAACGGCCAGCGACGCATCTTCTTCGTTCTCGACCGAGCTACACGCAAGTTCCACGGCGATATCAACC
TCTGGGTCCAGTATATCGAATATGCTCGCAAACAAAAGGCACACAAGAAGCTTCTCACGATTTTCACCGATGCTC
TGCGACTACACCCTACCAGCGCCGACTTATGGGTTTATGCCGCTAAGCACGTCCTCGATGACCACGGAGATATGA
CACAAGCTCGGAGTTACATGCAGCGCGGTTTACGGTTCTGCAAGAGCGCGAGGGCAATTTGGATTCAATATGCAA
AGCTGGAACTGATTTACATCGCAAAGCTGGTCGCTCGCCAACGGATTCTCGGTCTTGATGAGGAGAGCCAGAAGC
CCAAGGCCATCCAAGAAGCAGAAATTGACGACACTGATGCCGACATGATTGCGCTCCCATCACTCACAGCCGAGG
ACATCAACCCGAGCACAGGAGTGGACGGAGAAGTAGACCAGGTTGCGCTGCAAAACCTGAACTCCACGCCCGCTC
TGAGCGGTGCTATCCCGCTCGCCATCTTTGATACCGCCACGAAGCATTTCGACCACGATGATCGGTTCGGTCAGG
AGTTCTTCGACATGGCTTGGGAATTCGGGGATGTGCCTTGCCTTCGCAAGATTTTGGAACATGTGATTGAGACGA
TGCAGGCCAACAAGCCTTCCAGCCCACGGACGCAGATTTGCTACATTAAGTTCCCGACCGCTGGAATCCCTTCCA
CTTCGGCCGAATTCCCGCGGGCGCTTGGTACTTCGCTTGCCCGCCTCAGGGAGTATCCCATGGGCAAGGATCTCG
CACACCAAGTGATCAACTGGCTCCAACCCGTCCAGGCAACAAAGGATCTGGATCCTTCGTTGCAGAAGGTTATTG
CGGTTACCATCCGCAATGCGGAGCGCGCGGCACAGGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail