Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2587.t1
Gene name
Locationscaffold_03:418102..419784
Strand-
Gene length (bp)1682
Transcript length (bp)1632
Coding sequence length (bp)1632
Protein length (aa) 544

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01522 Polysacc_deac_1 Polysaccharide deacetylase 1.3E-17 237 381
PF10096 DUF2334 Uncharacterized protein conserved in bacteria (DUF2334) 5.9E-06 305 424

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds Yes
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2587.t1
MAHSLSNQSIIITGASAPFAEAFRACYGGTKNKTIAVNLDHLISSNLTEAQAQVNTAFSALGDRMEVLIIDARTQ
QPYGLDSIWEIPLSEWDQGHTSMSCRRKMLVQAKLFLQHQFQVSKLKAHENEPGSGFSVVVLGYQDLFGVSLDQV
ISKLQRDVSRLHPGASFNFLDLSTSREASVASIVAATATLVSAKPTCGIISLSDIASVNPTEKSKSDNFVAENTQ
LCQSLPFHHKHPKVKVALSFDFDAVSAFLGTGHHPDNNLADYSTGIFAGRVGANRLLRMLQKHQVADKVTWFIPG
HTMETFEATVKEIVKSGAEIGLHGYSHEGAYQMTPSQERDVLVKCMELAQRLTGKRVQGYRAPMYQLRETTIELL
REFEFLYDSSLSHHDSQPYFTPSDPPIKPVDFSQPASTWLRPTPLSETNARPVGHPLVEIPTGWNNEDMMALQYF
PHLDNTNGQVDARVVEQRWKDMFLWLWENADVDGGDGSFVFPILMHPDTSGMSHVIGMVDRFVGWLRGWGDAVQF
CTFESITRQWLEEQQKAK*
Coding >Pro_DTO377G3_2|g2587.t1
ATGGCTCACTCCCTGAGTAACCAATCTATCATCATAACAGGGGCCTCTGCACCATTTGCAGAGGCTTTTCGTGCC
TGCTATGGCGGTACCAAGAACAAGACTATCGCGGTCAACCTAGATCATCTAATATCTAGCAATTTGACCGAAGCT
CAGGCTCAGGTAAACACCGCTTTCAGCGCTCTTGGGGACCGAATGGAGGTTCTTATCATCGATGCCAGAACGCAG
CAGCCATATGGGCTAGACTCGATTTGGGAGATTCCGTTGAGTGAATGGGATCAGGGACACACATCCATGAGCTGT
CGGAGGAAAATGCTGGTGCAGGCAAAGTTGTTCCTTCAGCACCAATTCCAGGTCAGCAAGTTGAAGGCCCATGAG
AATGAACCAGGGAGCGGTTTTTCTGTTGTGGTCCTCGGTTATCAAGATCTCTTCGGTGTTTCACTCGATCAAGTT
ATTTCTAAACTCCAGAGAGACGTCTCACGACTTCACCCGGGTGCTTCTTTCAACTTCCTTGATCTTAGCACCTCA
AGAGAGGCCTCTGTCGCGTCCATCGTCGCGGCAACAGCGACACTGGTCTCAGCGAAACCCACCTGTGGAATAATC
TCGCTCAGCGACATTGCGAGTGTAAACCCCACTGAAAAGAGCAAAAGCGACAATTTCGTTGCTGAGAATACCCAG
CTTTGCCAAAGTCTCCCCTTCCATCATAAGCACCCAAAGGTCAAAGTTGCTTTGTCGTTTGACTTTGACGCAGTC
TCTGCCTTCCTGGGGACAGGACACCATCCAGACAACAACTTGGCAGACTACAGCACAGGCATATTCGCCGGTCGA
GTGGGTGCCAATCGGCTACTGCGCATGTTACAAAAACACCAAGTAGCCGACAAAGTCACTTGGTTCATCCCCGGG
CACACGATGGAAACCTTTGAAGCAACTGTCAAGGAGATTGTTAAGTCCGGTGCCGAGATAGGACTTCATGGTTAT
TCCCATGAAGGTGCCTACCAAATGACACCAAGTCAAGAGCGAGATGTGCTAGTGAAGTGCATGGAATTGGCCCAG
CGGCTAACCGGCAAAAGAGTGCAAGGCTATCGCGCGCCCATGTACCAGCTGCGCGAAACAACAATCGAGCTTCTG
AGGGAGTTTGAATTTCTATATGACTCCTCCCTGAGTCACCATGACTCACAGCCATATTTTACACCCAGCGATCCG
CCAATTAAACCGGTGGATTTCTCCCAGCCGGCCAGTACGTGGTTGCGCCCCACGCCGCTTTCTGAGACGAATGCC
CGCCCCGTCGGCCACCCACTTGTGGAAATTCCGACCGGCTGGAATAATGAAGATATGATGGCGTTACAGTACTTC
CCGCATCTCGACAATACCAATGGGCAGGTTGATGCACGGGTGGTTGAGCAGAGATGGAAGGACATGTTTCTGTGG
CTGTGGGAGAATGCAGACGTTGATGGGGGCGATGGAAGCTTTGTCTTCCCTATCTTGATGCATCCCGATACCAGT
GGCATGTCCCATGTGATAGGGATGGTTGATCGTTTTGTAGGGTGGCTCCGGGGATGGGGGGACGCAGTTCAGTTT
TGCACTTTTGAGAGTATCACACGGCAGTGGTTGGAAGAGCAGCAAAAGGCCAAATGA
Transcript >Pro_DTO377G3_2|g2587.t1
ATGGCTCACTCCCTGAGTAACCAATCTATCATCATAACAGGGGCCTCTGCACCATTTGCAGAGGCTTTTCGTGCC
TGCTATGGCGGTACCAAGAACAAGACTATCGCGGTCAACCTAGATCATCTAATATCTAGCAATTTGACCGAAGCT
CAGGCTCAGGTAAACACCGCTTTCAGCGCTCTTGGGGACCGAATGGAGGTTCTTATCATCGATGCCAGAACGCAG
CAGCCATATGGGCTAGACTCGATTTGGGAGATTCCGTTGAGTGAATGGGATCAGGGACACACATCCATGAGCTGT
CGGAGGAAAATGCTGGTGCAGGCAAAGTTGTTCCTTCAGCACCAATTCCAGGTCAGCAAGTTGAAGGCCCATGAG
AATGAACCAGGGAGCGGTTTTTCTGTTGTGGTCCTCGGTTATCAAGATCTCTTCGGTGTTTCACTCGATCAAGTT
ATTTCTAAACTCCAGAGAGACGTCTCACGACTTCACCCGGGTGCTTCTTTCAACTTCCTTGATCTTAGCACCTCA
AGAGAGGCCTCTGTCGCGTCCATCGTCGCGGCAACAGCGACACTGGTCTCAGCGAAACCCACCTGTGGAATAATC
TCGCTCAGCGACATTGCGAGTGTAAACCCCACTGAAAAGAGCAAAAGCGACAATTTCGTTGCTGAGAATACCCAG
CTTTGCCAAAGTCTCCCCTTCCATCATAAGCACCCAAAGGTCAAAGTTGCTTTGTCGTTTGACTTTGACGCAGTC
TCTGCCTTCCTGGGGACAGGACACCATCCAGACAACAACTTGGCAGACTACAGCACAGGCATATTCGCCGGTCGA
GTGGGTGCCAATCGGCTACTGCGCATGTTACAAAAACACCAAGTAGCCGACAAAGTCACTTGGTTCATCCCCGGG
CACACGATGGAAACCTTTGAAGCAACTGTCAAGGAGATTGTTAAGTCCGGTGCCGAGATAGGACTTCATGGTTAT
TCCCATGAAGGTGCCTACCAAATGACACCAAGTCAAGAGCGAGATGTGCTAGTGAAGTGCATGGAATTGGCCCAG
CGGCTAACCGGCAAAAGAGTGCAAGGCTATCGCGCGCCCATGTACCAGCTGCGCGAAACAACAATCGAGCTTCTG
AGGGAGTTTGAATTTCTATATGACTCCTCCCTGAGTCACCATGACTCACAGCCATATTTTACACCCAGCGATCCG
CCAATTAAACCGGTGGATTTCTCCCAGCCGGCCAGTACGTGGTTGCGCCCCACGCCGCTTTCTGAGACGAATGCC
CGCCCCGTCGGCCACCCACTTGTGGAAATTCCGACCGGCTGGAATAATGAAGATATGATGGCGTTACAGTACTTC
CCGCATCTCGACAATACCAATGGGCAGGTTGATGCACGGGTGGTTGAGCAGAGATGGAAGGACATGTTTCTGTGG
CTGTGGGAGAATGCAGACGTTGATGGGGGCGATGGAAGCTTTGTCTTCCCTATCTTGATGCATCCCGATACCAGT
GGCATGTCCCATGTGATAGGGATGGTTGATCGTTTTGTAGGGTGGCTCCGGGGATGGGGGGACGCAGTTCAGTTT
TGCACTTTTGAGAGTATCACACGGCAGTGGTTGGAAGAGCAGCAAAAGGCCAAATGA
Gene >Pro_DTO377G3_2|g2587.t1
ATGGCTCACTCCCTGAGTAACCAATCTATCATCATAACAGGGGCCTCTGCACCATTTGCAGAGGCTTTTCGTGCC
TGCTATGGCGGTAAGTTTAATTAGAAATAGAGAATTATATATCAGCTAACATCTATCAAGGTACCAAGAACAAGA
CTATCGCGGTCAACCTAGATCATCTAATATCTAGCAATTTGACCGAAGCTCAGGCTCAGGTAAACACCGCTTTCA
GCGCTCTTGGGGACCGAATGGAGGTTCTTATCATCGATGCCAGAACGCAGCAGCCATATGGGCTAGACTCGATTT
GGGAGATTCCGTTGAGTGAATGGGATCAGGGACACACATCCATGAGCTGTCGGAGGAAAATGCTGGTGCAGGCAA
AGTTGTTCCTTCAGCACCAATTCCAGGTCAGCAAGTTGAAGGCCCATGAGAATGAACCAGGGAGCGGTTTTTCTG
TTGTGGTCCTCGGTTATCAAGATCTCTTCGGTGTTTCACTCGATCAAGTTATTTCTAAACTCCAGAGAGACGTCT
CACGACTTCACCCGGGTGCTTCTTTCAACTTCCTTGATCTTAGCACCTCAAGAGAGGCCTCTGTCGCGTCCATCG
TCGCGGCAACAGCGACACTGGTCTCAGCGAAACCCACCTGTGGAATAATCTCGCTCAGCGACATTGCGAGTGTAA
ACCCCACTGAAAAGAGCAAAAGCGACAATTTCGTTGCTGAGAATACCCAGCTTTGCCAAAGTCTCCCCTTCCATC
ATAAGCACCCAAAGGTCAAAGTTGCTTTGTCGTTTGACTTTGACGCAGTCTCTGCCTTCCTGGGGACAGGACACC
ATCCAGACAACAACTTGGCAGACTACAGCACAGGCATATTCGCCGGTCGAGTGGGTGCCAATCGGCTACTGCGCA
TGTTACAAAAACACCAAGTAGCCGACAAAGTCACTTGGTTCATCCCCGGGCACACGATGGAAACCTTTGAAGCAA
CTGTCAAGGAGATTGTTAAGTCCGGTGCCGAGATAGGACTTCATGGTTATTCCCATGAAGGTGCCTACCAAATGA
CACCAAGTCAAGAGCGAGATGTGCTAGTGAAGTGCATGGAATTGGCCCAGCGGCTAACCGGCAAAAGAGTGCAAG
GCTATCGCGCGCCCATGTACCAGCTGCGCGAAACAACAATCGAGCTTCTGAGGGAGTTTGAATTTCTATATGACT
CCTCCCTGAGTCACCATGACTCACAGCCATATTTTACACCCAGCGATCCGCCAATTAAACCGGTGGATTTCTCCC
AGCCGGCCAGTACGTGGTTGCGCCCCACGCCGCTTTCTGAGACGAATGCCCGCCCCGTCGGCCACCCACTTGTGG
AAATTCCGACCGGCTGGAATAATGAAGATATGATGGCGTTACAGTACTTCCCGCATCTCGACAATACCAATGGGC
AGGTTGATGCACGGGTGGTTGAGCAGAGATGGAAGGACATGTTTCTGTGGCTGTGGGAGAATGCAGACGTTGATG
GGGGCGATGGAAGCTTTGTCTTCCCTATCTTGATGCATCCCGATACCAGTGGCATGTCCCATGTGATAGGGATGG
TTGATCGTTTTGTAGGGTGGCTCCGGGGATGGGGGGACGCAGTTCAGTTTTGCACTTTTGAGAGTATCACACGGC
AGTGGTTGGAAGAGCAGCAAAAGGCCAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail