Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2564.t1
Gene name
Locationscaffold_03:352941..353340
Strand+
Gene length (bp)399
Transcript length (bp)324
Coding sequence length (bp)324
Protein length (aa) 108

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 6 28 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 105.74 44.85 166.63
5d_25C Five days - 25 degrees Celsius 114.93 50.83 179.02
7d_25C Seven days - 25 degrees Celsius 116.14 51.56 180.71
10d_25C Ten days - 25 degrees Celsius 124.30 56.04 192.55
7d_15C Seven days - 15 degrees Celsius 190.63 94.18 287.09
7d_30C Seven days - 30 degrees Celsius 188.01 94.87 281.14

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.856473 no
3d_25C 7d_25C 0.836632 no
3d_25C 7d_15C 0.052372 no
3d_25C 7d_30C 0.059534 no
3d_25C 10d_25C 0.691426 no
5d_25C 7d_25C 0.983643 no
5d_25C 7d_15C 0.090345 no
5d_25C 7d_30C 0.102709 no
5d_25C 10d_25C 0.859040 no
7d_25C 7d_15C 0.093414 no
7d_25C 7d_30C 0.109209 no
7d_25C 10d_25C 0.879861 no
7d_15C 7d_30C 0.977596 no
7d_15C 10d_25C 0.159755 no
7d_30C 10d_25C 0.177767 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2564.t1
MGARNIIPLILLLVFVGIIAAVGFVVYSIMQDVGKNTREKMERKNIAFTKDGMKVQVREVKDEAYKDQTQSVLFN
MWNHTSFPAYKSRLWDMAGSSSSEQKVAEKRK*
Coding >Pro_DTO377G3_2|g2564.t1
ATGGGCGCCCGCAATATCATTCCCCTCATCCTGCTCCTCGTCTTTGTTGGCATCATCGCCGCGGTCGGATTTGTC
GTCTACAGCATCATGCAGGATGTAGGCAAAAATACGCGCGAAAAGATGGAGCGCAAGAATATAGCTTTCACCAAG
GACGGCATGAAGGTGCAAGTAAGGGAGGTCAAAGATGAGGCCTACAAGGACCAGACCCAGAGTGTCCTATTCAAC
ATGTGGAACCACACTTCCTTCCCCGCTTACAAAAGCCGACTGTGGGATATGGCTGGCTCGTCTTCATCGGAGCAG
AAGGTTGCTGAGAAACGCAAGTGA
Transcript >Pro_DTO377G3_2|g2564.t1
ATGGGCGCCCGCAATATCATTCCCCTCATCCTGCTCCTCGTCTTTGTTGGCATCATCGCCGCGGTCGGATTTGTC
GTCTACAGCATCATGCAGGATGTAGGCAAAAATACGCGCGAAAAGATGGAGCGCAAGAATATAGCTTTCACCAAG
GACGGCATGAAGGTGCAAGTAAGGGAGGTCAAAGATGAGGCCTACAAGGACCAGACCCAGAGTGTCCTATTCAAC
ATGTGGAACCACACTTCCTTCCCCGCTTACAAAAGCCGACTGTGGGATATGGCTGGCTCGTCTTCATCGGAGCAG
AAGGTTGCTGAGAAACGCAAGTGA
Gene >Pro_DTO377G3_2|g2564.t1
ATGGGCGCCCGCAATATCATTCCCCTCATCCTGCTCCTCGTCTTTGTTGGCATCATCGCCGCGGTCGGATTTGTC
GTCTACAGCATCATGCAGGATGTAGGCAAAAATACGCGCGAAAAGATGGAGCGCAAGAATATAGCTTTCACCAAG
GACGGCATGAAGGTGCAAGTAAGGGAGGTCAAAGATGAGGCCTACAAGGACCAGACCCAGAGGTGCGTTTCGTCT
TGCTGTGTTATTTTTCCCGCCCTTGCTTGTGCGTGACGACTGACCCGATATTTTCCCCATAGTGTCCTATTCAAC
ATGTGGAACCACACTTCCTTCCCCGCTTACAAAAGCCGACTGTGGGATATGGCTGGCTCGTCTTCATCGGAGCAG
AAGGTTGCTGAGAAACGCAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail