Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2548.t1
Gene name
Locationscaffold_03:304564..306487
Strand-
Gene length (bp)1923
Transcript length (bp)1743
Coding sequence length (bp)1743
Protein length (aa) 581

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 1.5E-52 115 449
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 4.9E-09 279 360

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

Domain # Start End Length
1 77 99 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 164.95 99.19 230.71
5d_25C Five days - 25 degrees Celsius 94.17 57.05 131.28
7d_25C Seven days - 25 degrees Celsius 98.82 59.45 138.19
10d_25C Ten days - 25 degrees Celsius 64.00 38.81 89.19
7d_15C Seven days - 15 degrees Celsius 116.10 70.79 161.40
7d_30C Seven days - 30 degrees Celsius 63.83 38.79 88.88

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.004450 yes
3d_25C 7d_25C 0.011993 yes
3d_25C 7d_15C 0.106191 no
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.880317 no
5d_25C 7d_15C 0.386714 no
5d_25C 7d_30C 0.070531 no
5d_25C 10d_25C 0.065980 no
7d_25C 7d_15C 0.535549 no
7d_25C 7d_30C 0.038966 yes
7d_25C 10d_25C 0.036724 yes
7d_15C 7d_30C 0.001804 yes
7d_15C 10d_25C 0.002297 yes
7d_30C 10d_25C 0.994184 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2548.t1
MAGSTLAIRKMAPSMQLSSMTRRSMSTQLALRAKPMRSTKLIQSVSRITRRGYADAASKPTPSPAPKPKKRFRAL
RWAWRLTWLSAIGLTGAVAYSIFDLRQPPDQAPPDPSKKTLVILGTGWGSVSLLKKLDTENYNVIVVSPRNYFLF
TPLLPSCTTGLIEHRSIMEPIRNILRHKKASVQFYEAEATKIDYEKRIVYISDDSEVKGDISHTEVPFDMLVIGV
GAENATFGIPGVRENSCFLKEVGDAQKIRKRIMDCIETACFKDQTEDEVKRLLHMVVVGGGPTGVEFAGELQDFF
NDDLRKWIPEIKDNFHVTLVEALPNVLPMFSKQLIDYTESTFKEEEISIRTKTMVKQVTDKYIQAEVTRPDGTKE
LETIPYGLLVWATGNAIRSVVRDLMSQIPAQAESRRGLAVNEYLVVNGTDNVWAVGDCAIANYAPTAQVAGQEGA
FLGRLFNTMAKTEALQQELETLSERQSHAKGDEERNLIFDEIRERQKQLRRNKQIGPFQYSHQGSLAYIGKERAV
ADISWLSGNIASGGTMTYLFWRSAYLSMCFSTRNRVLVCLDWVKARLFGRDVSRE*
Coding >Pro_DTO377G3_2|g2548.t1
ATGGCTGGCAGCACGCTAGCAATTCGCAAGATGGCTCCGTCCATGCAGCTGTCGTCCATGACGCGCAGATCGATG
TCCACGCAGCTGGCCCTTCGCGCAAAGCCGATGCGGTCGACCAAACTTATCCAGTCTGTGTCGCGCATCACTCGT
CGTGGCTACGCCGATGCTGCCTCGAAGCCTACCCCTTCACCCGCCCCGAAGCCTAAGAAGCGTTTCAGAGCTCTG
CGTTGGGCCTGGCGGTTGACTTGGCTCTCCGCCATCGGTCTAACCGGTGCTGTCGCATACAGCATCTTCGACCTC
CGCCAACCCCCGGACCAGGCCCCTCCTGACCCATCAAAGAAGACTCTGGTCATTCTTGGAACTGGCTGGGGCTCC
GTTTCCCTCCTGAAGAAGCTTGACACCGAGAACTACAATGTTATCGTCGTCTCTCCCCGTAATTACTTCCTCTTC
ACTCCCTTGCTGCCCTCATGTACCACCGGTTTGATTGAGCACCGCTCGATCATGGAGCCTATTCGAAATATCCTG
CGCCACAAGAAGGCCAGTGTTCAGTTCTACGAGGCCGAGGCAACCAAGATCGACTACGAGAAGCGGATTGTGTAT
ATCAGTGATGATTCGGAAGTTAAGGGTGATATCTCGCACACCGAAGTTCCCTTCGACATGCTCGTGATCGGTGTT
GGCGCCGAGAACGCGACTTTCGGTATTCCCGGTGTTCGTGAGAACTCCTGCTTCCTGAAGGAAGTTGGTGATGCC
CAAAAAATTCGTAAGCGTATTATGGACTGTATCGAGACTGCCTGTTTCAAGGATCAGACCGAGGACGAGGTCAAG
CGTCTGCTGCACATGGTTGTGGTGGGCGGTGGCCCCACTGGTGTTGAATTCGCCGGTGAACTCCAGGACTTCTTC
AATGATGACTTGAGGAAGTGGATTCCCGAAATCAAGGACAACTTCCACGTCACTCTCGTCGAGGCTCTACCCAAT
GTTCTGCCCATGTTCTCAAAGCAACTGATTGACTATACCGAATCCACCTTCAAGGAGGAGGAGATCTCCATCCGC
ACCAAGACCATGGTGAAGCAGGTTACCGACAAGTACATCCAGGCCGAGGTGACCAGGCCCGACGGTACCAAGGAA
CTTGAGACTATCCCTTACGGTCTTCTCGTCTGGGCCACCGGTAATGCTATCCGCAGCGTCGTCCGCGACCTCATG
TCCCAGATCCCTGCTCAGGCCGAGTCCCGCCGCGGTCTCGCTGTCAACGAATACCTCGTCGTGAACGGTACCGAC
AATGTCTGGGCCGTCGGCGACTGCGCCATTGCCAACTACGCCCCGACCGCCCAGGTTGCCGGCCAGGAAGGTGCT
TTCTTGGGCCGCCTCTTCAACACCATGGCCAAGACCGAGGCTCTCCAGCAAGAGTTGGAGACCCTGTCAGAGCGC
CAGTCCCACGCCAAGGGCGACGAGGAGCGCAACCTGATTTTCGACGAGATCCGTGAGCGCCAGAAGCAGCTCCGC
CGCAACAAGCAGATCGGTCCCTTCCAGTACTCGCACCAGGGCTCCTTGGCCTACATCGGTAAGGAGCGTGCCGTG
GCCGATATCAGCTGGCTGAGCGGCAACATCGCCAGCGGTGGTACTATGACCTACCTGTTCTGGCGCAGTGCCTAC
CTGAGCATGTGCTTCAGCACTCGCAACCGTGTCCTTGTCTGCCTCGACTGGGTCAAGGCTCGTCTCTTTGGTCGT
GATGTCTCGCGGGAGTAG
Transcript >Pro_DTO377G3_2|g2548.t1
ATGGCTGGCAGCACGCTAGCAATTCGCAAGATGGCTCCGTCCATGCAGCTGTCGTCCATGACGCGCAGATCGATG
TCCACGCAGCTGGCCCTTCGCGCAAAGCCGATGCGGTCGACCAAACTTATCCAGTCTGTGTCGCGCATCACTCGT
CGTGGCTACGCCGATGCTGCCTCGAAGCCTACCCCTTCACCCGCCCCGAAGCCTAAGAAGCGTTTCAGAGCTCTG
CGTTGGGCCTGGCGGTTGACTTGGCTCTCCGCCATCGGTCTAACCGGTGCTGTCGCATACAGCATCTTCGACCTC
CGCCAACCCCCGGACCAGGCCCCTCCTGACCCATCAAAGAAGACTCTGGTCATTCTTGGAACTGGCTGGGGCTCC
GTTTCCCTCCTGAAGAAGCTTGACACCGAGAACTACAATGTTATCGTCGTCTCTCCCCGTAATTACTTCCTCTTC
ACTCCCTTGCTGCCCTCATGTACCACCGGTTTGATTGAGCACCGCTCGATCATGGAGCCTATTCGAAATATCCTG
CGCCACAAGAAGGCCAGTGTTCAGTTCTACGAGGCCGAGGCAACCAAGATCGACTACGAGAAGCGGATTGTGTAT
ATCAGTGATGATTCGGAAGTTAAGGGTGATATCTCGCACACCGAAGTTCCCTTCGACATGCTCGTGATCGGTGTT
GGCGCCGAGAACGCGACTTTCGGTATTCCCGGTGTTCGTGAGAACTCCTGCTTCCTGAAGGAAGTTGGTGATGCC
CAAAAAATTCGTAAGCGTATTATGGACTGTATCGAGACTGCCTGTTTCAAGGATCAGACCGAGGACGAGGTCAAG
CGTCTGCTGCACATGGTTGTGGTGGGCGGTGGCCCCACTGGTGTTGAATTCGCCGGTGAACTCCAGGACTTCTTC
AATGATGACTTGAGGAAGTGGATTCCCGAAATCAAGGACAACTTCCACGTCACTCTCGTCGAGGCTCTACCCAAT
GTTCTGCCCATGTTCTCAAAGCAACTGATTGACTATACCGAATCCACCTTCAAGGAGGAGGAGATCTCCATCCGC
ACCAAGACCATGGTGAAGCAGGTTACCGACAAGTACATCCAGGCCGAGGTGACCAGGCCCGACGGTACCAAGGAA
CTTGAGACTATCCCTTACGGTCTTCTCGTCTGGGCCACCGGTAATGCTATCCGCAGCGTCGTCCGCGACCTCATG
TCCCAGATCCCTGCTCAGGCCGAGTCCCGCCGCGGTCTCGCTGTCAACGAATACCTCGTCGTGAACGGTACCGAC
AATGTCTGGGCCGTCGGCGACTGCGCCATTGCCAACTACGCCCCGACCGCCCAGGTTGCCGGCCAGGAAGGTGCT
TTCTTGGGCCGCCTCTTCAACACCATGGCCAAGACCGAGGCTCTCCAGCAAGAGTTGGAGACCCTGTCAGAGCGC
CAGTCCCACGCCAAGGGCGACGAGGAGCGCAACCTGATTTTCGACGAGATCCGTGAGCGCCAGAAGCAGCTCCGC
CGCAACAAGCAGATCGGTCCCTTCCAGTACTCGCACCAGGGCTCCTTGGCCTACATCGGTAAGGAGCGTGCCGTG
GCCGATATCAGCTGGCTGAGCGGCAACATCGCCAGCGGTGGTACTATGACCTACCTGTTCTGGCGCAGTGCCTAC
CTGAGCATGTGCTTCAGCACTCGCAACCGTGTCCTTGTCTGCCTCGACTGGGTCAAGGCTCGTCTCTTTGGTCGT
GATGTCTCGCGGGAGTAG
Gene >Pro_DTO377G3_2|g2548.t1
ATGGCTGGCAGCACGCTAGCAATTCGCAAGATGGCTCCGTCCATGCAGCTGTCGTCCATGACGCGCAGATCGATG
TCCACGCAGCTGGCCCTTCGCGCAAAGCCGATGCGGTCGACCAAACTTATCCAGTCTGTGTCGCGCATCACTCGT
CGTGGCTACGCCGATGCTGCCTCGAAGCCTACCCCTTCACCCGCCCCGAAGCCTAAGAAGCGTTTCAGAGCTCTG
CGTTGGGCCTGGCGGTTGACTTGGCTCTCCGCCATCGGTCTAACCGGTGCTGTCGCATACAGCATCTTCGACCTC
CGCCAACCCCCGGACCAGGCCCCTCCTGACCCATCAAAGAAGACTCTGGTCATTCTTGGTATGTATCGGTCGCGA
TTGTACCCCTACAGCCGACGTGTCGCTAACGCGACTGTGCTCGTTCAGGAACTGGCTGGGGCTCCGTTTCCCTCC
TGAAGAAGCTTGACACCGAGAACTACAATGTTATCGTCGTCTCTCCCCGTAATTACTTCCTCTTCACTCCCTTGC
TGCCCTCATGTACCACCGGTTTGATTGAGCACCGCTCGATCATGGAGCCTATTCGAAATATCCTGCGCCACAAGA
AGGCCAGTGTTCAGTTCTACGAGGCCGAGGCAACCAAGATCGACTACGAGAAGCGGATTGTGTATATCAGTGATG
ATTCGGAAGTTAAGGGTGATATCTCGCACACCGAAGTTCCCTTCGACATGCTCGTGATCGGTGTTGGCGCCGAGA
ACGCGACTTTCGGTAGGATTCACTCTCGCATCTGAAACGATGCATTTTGGACTAATATCGTAACCTATAGGTATT
CCCGGTGTTCGTGAGAACTCCTGCTTCCTGAAGGAAGTTGGTGATGCCCAAAAAATTCGTAAGCGTATTATGGAC
TGTATCGAGACTGCCTGTTTCAAGGATCAGACCGAGGACGAGGTCAAGCGTCTGCTGCACATGGTTGTGGTGGGC
GGTGGCCCCACTGGTGTTGAATTCGCCGGTGAACTCCAGGACTTCTTCAATGATGACTTGAGGAAGTGGATTCCC
GAAATCAAGGACAACTTCCACGTCACTCTCGTCGAGGCTCTACCCAATGTTCTGCCCATGTTCTCAAAGCAACTG
ATTGACTATACCGAATCCACCTTCAAGGAGGAGGAGATCTCCATCCGCACCAAGACCATGGTGAAGCAGGTTACC
GACAAGTACATCCAGGCCGAGGTGACCAGGCCCGACGGTACCAAGGAACTTGAGACTATCCCTTACGGTCTTCTC
GTCTGGGCCACCGGTAATGCTATCCGCAGCGTCGTCCGCGACCTCATGTCCCAGATCCCTGCTCAGGCCGAGTCC
CGCCGCGGTCTCGCTGTCAACGAATACCTCGTCGTGAACGGTACCGACAATGTCTGGGCCGTCGGCGACTGCGCC
ATTGCCAACTACGCCCCGACCGCCCAGGTTGCCGGCCAGGAAGGTGCTTTCTTGGGCCGCCTCTTCAACACCATG
GCCAAGACCGAGGCTCTCCAGCAAGAGTTGGAGACCCTGTCAGAGCGCCAGTCCCACGCCAAGGGCGACGAGGAG
CGCAACCTGATTTTCGACGAGATCCGTGAGCGCCAGAAGCAGCTCCGCCGCAACAAGCAGATCGGTCCCTTCCAG
TACTCGCACCAGGGCTCCTTGGCCTACATCGGTAAGGAGCGTGCCGTGGCCGATATCAGCTGGCTGAGCGGCAAC
ATCGCCAGCGGTGGTACTATGACCTACCTGTTCTGGCGCAGTGCCTACCTGAGCATGTGCTTCAGCAGTAAGTTC
TAAGCTCTATCCAACACTGATTGAAAGTCATCATTAACATATAATCTAGCTCGCAACCGTGTCCTTGTCTGCCTC
GACTGGGTCAAGGCTCGTCTCTTTGGTCGTGATGTCTCGCGGGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail