Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2545.t1
Gene name
Locationscaffold_03:296932..298419
Strand-
Gene length (bp)1487
Transcript length (bp)1299
Coding sequence length (bp)1299
Protein length (aa) 433

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05057 DUF676 Putative serine esterase (DUF676) 2.1E-04 4 152

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 79.57 48.62 110.52
5d_25C Five days - 25 degrees Celsius 112.40 68.57 156.22
7d_25C Seven days - 25 degrees Celsius 107.58 65.87 149.28
10d_25C Ten days - 25 degrees Celsius 140.10 85.49 194.71
7d_15C Seven days - 15 degrees Celsius 146.91 86.85 206.97
7d_30C Seven days - 30 degrees Celsius 96.41 58.04 134.78

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.119590 no
3d_25C 7d_25C 0.175871 no
3d_25C 7d_15C 0.002761 yes
3d_25C 7d_30C 0.437523 no
3d_25C 10d_25C 0.004045 yes
5d_25C 7d_25C 0.895186 no
5d_25C 7d_15C 0.254913 no
5d_25C 7d_30C 0.556939 no
5d_25C 10d_25C 0.364628 no
7d_25C 7d_15C 0.173213 no
7d_25C 7d_30C 0.695340 no
7d_25C 10d_25C 0.251401 no
7d_15C 7d_30C 0.046159 yes
7d_15C 10d_25C 0.884710 no
7d_30C 10d_25C 0.076548 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2545.t1
MRKTLLLVFIHGFKGGDDTFGTFPEYLRVFASRALPAVEVATAVYPKYETKGDLKECVARLRDWLQDTVIDLEVA
SHTASPTVDPSVHVVLIGHSMGGIVGADVLLLLAAEQPIPRNTQPGLNGIESIVEPGTFMFPHIQGVLAFDTPFL
GIAPGVLSYGAEGHYRTAATAYNTFSEVAGLFGYGGNNASNQGTTHASPKESPKMSPSTPDAAATPSWQRWGKYA
MFAGAAGAVAAGGAALYTQRQKLTDGFGWVSSHLEFVGCLARTSELHERLLRLSSLKEERGIGCVNFYTCLGKNA
TSLVEKTSANKTSFSQKIIRSRNRTFCSLPAEVERGEGSQSPGLLWTRAVNDQATDETNAHITMFLSKENPAFFE
MLREACAVLVKSIDKGWYDSSTEPPKKDDIKQPHATEGTKTKTDGDFMDGDDVVVVD*
Coding >Pro_DTO377G3_2|g2545.t1
ATGAGGAAGACTTTACTACTCGTCTTTATTCACGGTTTCAAGGGCGGCGATGATACTTTTGGCACGTTCCCTGAG
TATTTGCGCGTTTTCGCAAGCAGAGCACTTCCTGCGGTCGAGGTCGCCACTGCTGTCTACCCCAAGTATGAGACT
AAAGGTGACTTGAAAGAGTGCGTGGCAAGATTGCGAGATTGGTTACAAGATACTGTGATTGATCTTGAAGTAGCC
AGCCATACGGCATCACCCACCGTTGATCCCTCGGTCCATGTCGTTCTGATCGGTCACTCAATGGGAGGAATAGTA
GGAGCAGATGTTCTCCTTTTGCTAGCAGCGGAACAACCAATTCCTCGAAATACGCAGCCAGGGTTAAATGGCATC
GAATCTATCGTGGAACCGGGTACTTTCATGTTCCCTCATATACAAGGAGTGCTTGCATTTGATACCCCATTCTTG
GGCATAGCGCCAGGAGTTCTGTCATATGGCGCAGAAGGACACTATCGTACTGCTGCAACCGCCTACAATACCTTC
TCCGAGGTAGCAGGTCTGTTCGGTTACGGTGGGAACAATGCATCAAACCAGGGGACCACCCATGCATCCCCGAAA
GAGTCCCCCAAAATGTCGCCTTCCACACCCGACGCCGCCGCGACACCTTCCTGGCAACGATGGGGTAAATATGCC
ATGTTCGCTGGCGCGGCTGGTGCTGTTGCCGCTGGCGGCGCAGCCTTATATACGCAACGCCAGAAGCTCACTGAC
GGGTTTGGATGGGTATCATCGCACCTCGAGTTTGTTGGTTGTCTCGCGCGCACGTCGGAATTGCACGAGCGTCTC
CTGCGATTGTCAAGTCTCAAGGAGGAACGTGGCATCGGATGTGTGAACTTCTACACATGCCTCGGAAAAAATGCG
ACTAGTCTTGTGGAAAAAACATCAGCAAACAAAACATCCTTCAGCCAGAAAATCATTAGGTCGAGGAACAGGACC
TTCTGTTCATTGCCAGCAGAGGTGGAACGTGGCGAGGGATCTCAAAGTCCAGGACTTTTGTGGACCAGGGCAGTT
AATGACCAGGCTACTGACGAAACAAACGCACATATTACCATGTTTCTGTCCAAAGAGAATCCTGCATTTTTTGAA
ATGCTCAGGGAAGCGTGTGCGGTCTTGGTCAAGTCGATAGACAAAGGCTGGTATGATTCGTCCACCGAACCGCCC
AAGAAAGACGATATCAAGCAACCACATGCAACAGAGGGCACAAAAACCAAAACAGACGGGGACTTCATGGATGGC
GATGACGTTGTTGTCGTTGACTGA
Transcript >Pro_DTO377G3_2|g2545.t1
ATGAGGAAGACTTTACTACTCGTCTTTATTCACGGTTTCAAGGGCGGCGATGATACTTTTGGCACGTTCCCTGAG
TATTTGCGCGTTTTCGCAAGCAGAGCACTTCCTGCGGTCGAGGTCGCCACTGCTGTCTACCCCAAGTATGAGACT
AAAGGTGACTTGAAAGAGTGCGTGGCAAGATTGCGAGATTGGTTACAAGATACTGTGATTGATCTTGAAGTAGCC
AGCCATACGGCATCACCCACCGTTGATCCCTCGGTCCATGTCGTTCTGATCGGTCACTCAATGGGAGGAATAGTA
GGAGCAGATGTTCTCCTTTTGCTAGCAGCGGAACAACCAATTCCTCGAAATACGCAGCCAGGGTTAAATGGCATC
GAATCTATCGTGGAACCGGGTACTTTCATGTTCCCTCATATACAAGGAGTGCTTGCATTTGATACCCCATTCTTG
GGCATAGCGCCAGGAGTTCTGTCATATGGCGCAGAAGGACACTATCGTACTGCTGCAACCGCCTACAATACCTTC
TCCGAGGTAGCAGGTCTGTTCGGTTACGGTGGGAACAATGCATCAAACCAGGGGACCACCCATGCATCCCCGAAA
GAGTCCCCCAAAATGTCGCCTTCCACACCCGACGCCGCCGCGACACCTTCCTGGCAACGATGGGGTAAATATGCC
ATGTTCGCTGGCGCGGCTGGTGCTGTTGCCGCTGGCGGCGCAGCCTTATATACGCAACGCCAGAAGCTCACTGAC
GGGTTTGGATGGGTATCATCGCACCTCGAGTTTGTTGGTTGTCTCGCGCGCACGTCGGAATTGCACGAGCGTCTC
CTGCGATTGTCAAGTCTCAAGGAGGAACGTGGCATCGGATGTGTGAACTTCTACACATGCCTCGGAAAAAATGCG
ACTAGTCTTGTGGAAAAAACATCAGCAAACAAAACATCCTTCAGCCAGAAAATCATTAGGTCGAGGAACAGGACC
TTCTGTTCATTGCCAGCAGAGGTGGAACGTGGCGAGGGATCTCAAAGTCCAGGACTTTTGTGGACCAGGGCAGTT
AATGACCAGGCTACTGACGAAACAAACGCACATATTACCATGTTTCTGTCCAAAGAGAATCCTGCATTTTTTGAA
ATGCTCAGGGAAGCGTGTGCGGTCTTGGTCAAGTCGATAGACAAAGGCTGGTATGATTCGTCCACCGAACCGCCC
AAGAAAGACGATATCAAGCAACCACATGCAACAGAGGGCACAAAAACCAAAACAGACGGGGACTTCATGGATGGC
GATGACGTTGTTGTCGTTGACTGA
Gene >Pro_DTO377G3_2|g2545.t1
ATGAGGAAGACTTTACTACTCGTCTTTATTCACGGTTTCAAGGTATGCAAAATGCCTGCTTGTTGAAGACCTGGT
CCCCGCAAAGAATTACAGATTTCAGCCCAACAAGATTTGTTTTTTTGACCTAGAACTTACGTTGACTGATAAAAT
CCAATTCTAGGGCGGCGATGATACTTTTGGCACGTTCCCTGAGTATTTGCGCGTTTTCGCAAGCAGAGCACTTCC
TGCGGTCGAGGTCGCCACTGCTGTCTACCCCAAGTATGAGACTAAAGGTGACTTGAAAGAGTGCGTGGCAAGATT
GCGAGATTGGTAAGACTATGCTCAGCTCCTCTTGTGAACACATACAGGTTTTACTTACGACGATATCTCTTCTGT
GTAGGTTACAAGATACTGTGATTGATCTTGAAGTAGCCAGCCATACGGCATCACCCACCGTTGATCCCTCGGTCC
ATGTCGTTCTGATCGGTCACTCAATGGGAGGAATAGTAGGAGCAGATGTTCTCCTTTTGCTAGCAGCGGAACAAC
CAATTCCTCGAAATACGCAGCCAGGGTTAAATGGCATCGAATCTATCGTGGAACCGGGTACTTTCATGTTCCCTC
ATATACAAGGAGTGCTTGCATTTGATACCCCATTCTTGGGCATAGCGCCAGGAGTTCTGTCATATGGCGCAGAAG
GACACTATCGTACTGCTGCAACCGCCTACAATACCTTCTCCGAGGTAGCAGGTCTGTTCGGTTACGGTGGGAACA
ATGCATCAAACCAGGGGACCACCCATGCATCCCCGAAAGAGTCCCCCAAAATGTCGCCTTCCACACCCGACGCCG
CCGCGACACCTTCCTGGCAACGATGGGGTAAATATGCCATGTTCGCTGGCGCGGCTGGTGCTGTTGCCGCTGGCG
GCGCAGCCTTATATACGCAACGCCAGAAGCTCACTGACGGGTTTGGATGGGTATCATCGCACCTCGAGTTTGTTG
GTTGTCTCGCGCGCACGTCGGAATTGCACGAGCGTCTCCTGCGATTGTCAAGTCTCAAGGAGGAACGTGGCATCG
GATGTGTGAACTTCTACACATGCCTCGGAAAAAATGCGACTAGTCTTGTGGAAAAAACATCAGCAAACAAAACAT
CCTTCAGCCAGAAAATCATTAGGTCGAGGAACAGGACCTTCTGTTCATTGCCAGCAGAGGTGGAACGTGGCGAGG
GATCTCAAAGTCCAGGACTTTTGTGGACCAGGGCAGTTAATGACCAGGCTACTGACGAAACAAACGCACATATTA
CCATGTTTCTGTCCAAAGAGAATCCTGCATTTTTTGAAATGCTCAGGGAAGCGTGTGCGGTCTTGGTCAAGTCGA
TAGACAAAGGCTGGTATGATTCGTCCACCGAACCGCCCAAGAAAGACGATATCAAGCAACCACATGCAACAGAGG
GCACAAAAACCAAAACAGACGGGGACTTCATGGATGGCGATGACGTTGTTGTCGTTGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail