Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g254.t1
Gene name
Locationscaffold_01:661971..663625
Strand-
Gene length (bp)1654
Transcript length (bp)1533
Coding sequence length (bp)1533
Protein length (aa) 511

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00320 GATA GATA zinc finger 2.7E-13 73 104
PF00320 GATA GATA zinc finger 2.2E-14 216 248

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0043565 sequence-specific DNA binding Yes
GO:0065007 biological regulation No
GO:0031323 regulation of cellular metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0008150 biological_process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0003677 DNA binding No
GO:0003676 nucleic acid binding No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0010468 regulation of gene expression No
GO:0050789 regulation of biological process No
GO:0005488 binding No
GO:2001141 regulation of RNA biosynthetic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0003674 molecular_function No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0019222 regulation of metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0080090 regulation of primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0009889 regulation of biosynthetic process No
GO:0050794 regulation of cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
GATA type zinc finger

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 41.12 24.15 58.10
5d_25C Five days - 25 degrees Celsius 56.20 33.74 78.67
7d_25C Seven days - 25 degrees Celsius 64.43 39.16 89.71
10d_25C Ten days - 25 degrees Celsius 75.17 45.76 104.58
7d_15C Seven days - 15 degrees Celsius 74.97 45.51 104.43
7d_30C Seven days - 30 degrees Celsius 53.53 32.12 74.94

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.176561 no
3d_25C 7d_25C 0.038184 yes
3d_25C 7d_15C 0.005235 yes
3d_25C 7d_30C 0.273843 no
3d_25C 10d_25C 0.004045 yes
5d_25C 7d_25C 0.632239 no
5d_25C 7d_15C 0.216420 no
5d_25C 7d_30C 0.885880 no
5d_25C 10d_25C 0.212206 no
7d_25C 7d_15C 0.572088 no
7d_25C 7d_30C 0.475837 no
7d_25C 10d_25C 0.564691 no
7d_15C 7d_30C 0.132031 no
7d_15C 10d_25C 0.993865 no
7d_30C 10d_25C 0.125142 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g254.t1
MRQPSAEDLDAAQQLISSAQAGREHLADHYRDDGMGQGSGQSGSNQWIGHNEIPSEKTSPGSQKDTTFLGHSCSN
CGTKSTPLWRRSPTGAMICNACGLYLKARNVARPTKRNRMQSEGAEKPPPPMRSHCGGSSEGGCKGSCPGGGSCN
GTGGAEGCDGCPAYNNRIYKSAPRGAAAIQSSWGRNPAQDLEPVTQEEPPVKAPASADGTNTLVACQNCGTTVTP
LWRRDEQGHPICNACGLYYKLHGCYRPTNMKKSIIKRRKRVVPALRDQSPTAATLSSNGSSASPEASPAALAHGH
DDHYRYMSSEPTDHYPMMPGKSEDAPRVLHFAPPPVDFTGYNVSSVPLAHGLSISHGLPKPLGVERLGHSPAPQY
GRRSASPNSINLPKKRTLAETATEALPAPSTLEAGSNQLPPIMSSANPTPPGRLSSISSILNQSDVRGEPRSDTN
LGRPPPIHHSISPSPHPSQPLPGIASLGDSVDRRARLEREAEQMREMLRAKERELAEMRR*
Coding >Pro_DTO377G3_2|g254.t1
ATGCGACAACCGTCCGCGGAGGATTTGGATGCTGCGCAGCAGTTGATCTCCTCAGCACAAGCAGGTCGTGAACAT
CTAGCAGATCACTACCGGGACGATGGCATGGGGCAAGGATCGGGTCAATCTGGATCAAATCAATGGATTGGACAC
AACGAAATCCCGAGCGAGAAAACATCCCCCGGCAGCCAAAAAGACACAACTTTTCTAGGGCATTCATGCAGTAAT
TGCGGCACAAAAAGTACTCCTCTTTGGCGTCGTTCTCCCACGGGAGCCATGATCTGCAACGCCTGCGGTCTCTAC
CTCAAAGCTCGCAATGTCGCTCGCCCCACGAAACGAAATCGGATGCAATCAGAAGGTGCCGAGAAGCCACCGCCT
CCTATGCGGTCTCACTGTGGCGGTTCCTCGGAAGGAGGTTGCAAGGGGTCATGCCCTGGCGGTGGGAGTTGTAAT
GGCACCGGTGGCGCAGAAGGATGCGATGGATGCCCGGCATACAACAACCGGATATACAAGTCCGCCCCCCGGGGA
GCGGCTGCCATCCAATCTTCGTGGGGCCGTAACCCAGCACAAGACCTTGAGCCTGTGACGCAAGAGGAGCCACCG
GTGAAGGCCCCTGCTTCTGCCGATGGCACTAATACATTGGTTGCTTGTCAAAATTGCGGCACGACTGTGACTCCT
CTGTGGAGGCGCGATGAACAGGGCCACCCTATTTGCAACGCTTGTGGATTGTATTATAAGCTCCATGGATGCTAT
CGCCCCACCAACATGAAAAAGTCCATCATCAAACGTCGCAAACGGGTTGTTCCCGCCCTACGAGATCAGTCTCCC
ACCGCTGCTACCCTTTCCTCCAATGGCTCATCGGCATCCCCGGAGGCATCGCCTGCCGCCCTGGCGCATGGCCAT
GATGATCACTATCGATATATGAGCAGCGAGCCTACGGATCACTACCCGATGATGCCTGGAAAATCCGAAGACGCA
CCTCGAGTTTTACATTTTGCGCCACCGCCGGTTGATTTCACTGGTTACAATGTTTCATCCGTGCCTCTTGCACAT
GGTCTCTCCATCTCTCACGGCCTACCTAAACCTTTGGGGGTGGAGCGGCTGGGGCATTCGCCCGCGCCTCAGTAC
GGGCGACGGTCCGCCTCTCCAAATTCCATCAACCTCCCCAAGAAACGAACATTGGCCGAGACTGCGACAGAGGCT
CTACCCGCTCCATCTACATTGGAAGCAGGATCCAACCAACTGCCTCCGATTATGTCTTCGGCCAATCCTACTCCC
CCCGGTCGTCTCAGCTCTATCTCGTCTATTCTGAACCAATCAGATGTTCGGGGCGAGCCTCGCTCGGATACCAAT
CTGGGACGTCCACCTCCTATTCACCATTCTATCTCCCCTTCACCTCACCCGTCACAGCCTTTGCCTGGAATTGCA
TCTCTTGGAGACTCGGTTGATCGCCGTGCCCGACTTGAACGCGAAGCTGAGCAGATGCGCGAGATGCTCAGAGCA
AAGGAGCGCGAGCTGGCAGAGATGAGACGATAG
Transcript >Pro_DTO377G3_2|g254.t1
ATGCGACAACCGTCCGCGGAGGATTTGGATGCTGCGCAGCAGTTGATCTCCTCAGCACAAGCAGGTCGTGAACAT
CTAGCAGATCACTACCGGGACGATGGCATGGGGCAAGGATCGGGTCAATCTGGATCAAATCAATGGATTGGACAC
AACGAAATCCCGAGCGAGAAAACATCCCCCGGCAGCCAAAAAGACACAACTTTTCTAGGGCATTCATGCAGTAAT
TGCGGCACAAAAAGTACTCCTCTTTGGCGTCGTTCTCCCACGGGAGCCATGATCTGCAACGCCTGCGGTCTCTAC
CTCAAAGCTCGCAATGTCGCTCGCCCCACGAAACGAAATCGGATGCAATCAGAAGGTGCCGAGAAGCCACCGCCT
CCTATGCGGTCTCACTGTGGCGGTTCCTCGGAAGGAGGTTGCAAGGGGTCATGCCCTGGCGGTGGGAGTTGTAAT
GGCACCGGTGGCGCAGAAGGATGCGATGGATGCCCGGCATACAACAACCGGATATACAAGTCCGCCCCCCGGGGA
GCGGCTGCCATCCAATCTTCGTGGGGCCGTAACCCAGCACAAGACCTTGAGCCTGTGACGCAAGAGGAGCCACCG
GTGAAGGCCCCTGCTTCTGCCGATGGCACTAATACATTGGTTGCTTGTCAAAATTGCGGCACGACTGTGACTCCT
CTGTGGAGGCGCGATGAACAGGGCCACCCTATTTGCAACGCTTGTGGATTGTATTATAAGCTCCATGGATGCTAT
CGCCCCACCAACATGAAAAAGTCCATCATCAAACGTCGCAAACGGGTTGTTCCCGCCCTACGAGATCAGTCTCCC
ACCGCTGCTACCCTTTCCTCCAATGGCTCATCGGCATCCCCGGAGGCATCGCCTGCCGCCCTGGCGCATGGCCAT
GATGATCACTATCGATATATGAGCAGCGAGCCTACGGATCACTACCCGATGATGCCTGGAAAATCCGAAGACGCA
CCTCGAGTTTTACATTTTGCGCCACCGCCGGTTGATTTCACTGGTTACAATGTTTCATCCGTGCCTCTTGCACAT
GGTCTCTCCATCTCTCACGGCCTACCTAAACCTTTGGGGGTGGAGCGGCTGGGGCATTCGCCCGCGCCTCAGTAC
GGGCGACGGTCCGCCTCTCCAAATTCCATCAACCTCCCCAAGAAACGAACATTGGCCGAGACTGCGACAGAGGCT
CTACCCGCTCCATCTACATTGGAAGCAGGATCCAACCAACTGCCTCCGATTATGTCTTCGGCCAATCCTACTCCC
CCCGGTCGTCTCAGCTCTATCTCGTCTATTCTGAACCAATCAGATGTTCGGGGCGAGCCTCGCTCGGATACCAAT
CTGGGACGTCCACCTCCTATTCACCATTCTATCTCCCCTTCACCTCACCCGTCACAGCCTTTGCCTGGAATTGCA
TCTCTTGGAGACTCGGTTGATCGCCGTGCCCGACTTGAACGCGAAGCTGAGCAGATGCGCGAGATGCTCAGAGCA
AAGGAGCGCGAGCTGGCAGAGATGAGACGATAG
Gene >Pro_DTO377G3_2|g254.t1
ATGCGACAACCGTCCGCGGAGGATTTGGATGCTGCGCAGCAGTTGATCTCCTCAGCACAAGCAGGTCGTGAACAT
CTAGCAGATCACTACCGGGACGATGGCATGGGGCAAGGATCGGGTCAATCTGGATCAAATCAATGGATTGGACAC
AACGAAATCCCGAGCGAGAAAACATCCCCCGGCAGCCAAAAAGACACAACTTTTCTAGGGCATTCATGCAGGTGA
GTTTCGACTGGGCCTCGGTTGATACTTAGGCTATAAAGACTGACCCCGTCTCTTTTATTCAGTAATTGCGGCACA
AAAAGTACTCCTCTTTGGCGTCGTTCTCCCACGGGAGCCATGATCTGCAACGCCTGCGGTCTCTACCTCAAAGCT
CGCAATGTCGCTCGCCCCACGAAACGAAATCGGATGCAATCAGAAGGTGCCGAGAAGCCACCGCCTCCTATGCGG
TCTCACTGTGGCGGTTCCTCGGAAGGAGGTTGCAAGGGGTCATGCCCTGGCGGTGGGAGTTGTAATGGCACCGGT
GGCGCAGAAGGATGCGATGGATGCCCGGCATACAACAACCGGATATACAAGTCCGCCCCCCGGGGAGCGGCTGCC
ATCCAATCTTCGTGGGGCCGTAACCCAGCACAAGACCTTGAGCCTGTGACGCAAGAGGAGCCACCGGTGAAGGCC
CCTGCTTCTGCCGATGGCACTAATACATTGGTTGCTTGTCAAAATTGCGGCACGACTGTGACTCCTCTGTGGAGG
CGCGATGAACAGGGCCACCCTATTTGCAACGCTTGTGGTAAGTTTGAGTTTCCATATAGACTTGATGATCTGATT
TCTCTAACACAAGACAGGATTGTATTATAAGCTCCATGGATGCTATCGCCCCACCAACATGAAAAAGTCCATCAT
CAAACGTCGCAAACGGGTTGTTCCCGCCCTACGAGATCAGTCTCCCACCGCTGCTACCCTTTCCTCCAATGGCTC
ATCGGCATCCCCGGAGGCATCGCCTGCCGCCCTGGCGCATGGCCATGATGATCACTATCGATATATGAGCAGCGA
GCCTACGGATCACTACCCGATGATGCCTGGAAAATCCGAAGACGCACCTCGAGTTTTACATTTTGCGCCACCGCC
GGTTGATTTCACTGGTTACAATGTTTCATCCGTGCCTCTTGCACATGGTCTCTCCATCTCTCACGGCCTACCTAA
ACCTTTGGGGGTGGAGCGGCTGGGGCATTCGCCCGCGCCTCAGTACGGGCGACGGTCCGCCTCTCCAAATTCCAT
CAACCTCCCCAAGAAACGAACATTGGCCGAGACTGCGACAGAGGCTCTACCCGCTCCATCTACATTGGAAGCAGG
ATCCAACCAACTGCCTCCGATTATGTCTTCGGCCAATCCTACTCCCCCCGGTCGTCTCAGCTCTATCTCGTCTAT
TCTGAACCAATCAGATGTTCGGGGCGAGCCTCGCTCGGATACCAATCTGGGACGTCCACCTCCTATTCACCATTC
TATCTCCCCTTCACCTCACCCGTCACAGCCTTTGCCTGGAATTGCATCTCTTGGAGACTCGGTTGATCGCCGTGC
CCGACTTGAACGCGAAGCTGAGCAGATGCGCGAGATGCTCAGAGCAAAGGAGCGCGAGCTGGCAGAGATGAGACG
ATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail