Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2534.t1
Gene name
Locationscaffold_03:268126..270550
Strand+
Gene length (bp)2424
Transcript length (bp)2424
Coding sequence length (bp)2424
Protein length (aa) 808

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12678 zf-rbx1 RING-H2 zinc finger domain 2.5E-08 737 801
PF13639 zf-RING_2 Ring finger domain 1.3E-07 774 801
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 2.1E-06 737 800

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0008270 zinc ion binding Yes
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0043167 ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 387 404 17
2 417 439 22
3 443 465 22
4 554 576 22
5 580 599 19
6 620 639 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2534.t1
MDNRGSFFFFVLVFYLLFSSQSRPPLIDEDRARQRELDHERQVLRLLNGSKYGDFDPPANRWLPFSGSRGNDSYA
WDLFPQVKGLARHQLQSAVSNAGLESPDGLEDPIVSPTLNLTKLLLPIYRNSTGKLRGDWVRRTEGVHRREPLNT
TAIAEEHEYFTHEFSHNITGNSGTFYFDLEEGGGEELQMGDGLLREMRASLTVESEDFWGSTWYISLLGVHFPDT
GSIVLTTSSEKFGGIFSLPHFMLSSDTYELSHELLLKSLSDTISEKQNRPPTLFPWSSLTGTEQMEFPAPKCEHI
IYLQQHPVMLEDAVADRLLLERMEQELRYPMGAPIPDPPLMVMSAVVFSPDCGYILQTKGTPEFPPSDALYVTGP
KHEEYSKYASRLIFVVSGVFVAQITLLLRQIKEASTPSTRSRISFYTIALMALGDAFVLTFIVLELYAAVSFLVL
ATASFLAFLSVSYIGMKFMMEIWAVQEPERREQDRPPNPSTPTTRPGTLPLPATASEARDSGATPIILSPDQDAP
DDEMDSPPPTTRATPPTPRQIRSDVGTMYARFYLTLFGMLILSIWAFLLPRRLGSIYTRFLAAVYLSFWVPQVYR
NAMRNCRKALRWDFVAGQSVLRLFPFLYFLTARGNVLFIRPDYTSAFIMTGWVWIQAWILVSQDVLGPRFFVPRG
WAPHAYDYHPMLRDLSGADEDLEAGGGVLSIASLRGDERDLVSDSKDDDKQRKDRKKAIFDCAICMQDIEVPVLP
APSASGGSSVTDGAASILSRRLYMVTPCRHIFHTACLESWMRLRLQCPICRESIPPV*
Coding >Pro_DTO377G3_2|g2534.t1
ATGGATAACCGCGGCTCCTTTTTCTTCTTCGTGCTGGTGTTCTACCTTCTCTTCAGTTCCCAGTCTCGACCGCCA
TTGATCGATGAAGATCGGGCACGGCAACGTGAGCTTGACCATGAGCGACAGGTCCTTCGGTTATTGAATGGATCA
AAATATGGCGACTTCGATCCGCCCGCCAATCGATGGCTTCCTTTTTCGGGTTCAAGAGGGAATGACAGCTATGCT
TGGGACCTTTTTCCGCAGGTCAAAGGCCTGGCTCGCCACCAGTTACAATCAGCGGTCTCAAATGCCGGGCTAGAA
TCCCCGGACGGTCTAGAAGACCCCATTGTCTCGCCTACTTTGAACTTGACCAAGCTTCTGCTTCCGATATATCGC
AACTCAACCGGGAAGCTGCGGGGGGACTGGGTTCGGCGAACTGAAGGTGTTCATCGCCGTGAACCTCTGAACACG
ACAGCCATCGCTGAAGAACACGAATACTTTACTCATGAATTCAGTCATAATATCACTGGCAATAGCGGCACCTTT
TACTTTGATCTTGAAGAGGGAGGTGGTGAAGAACTTCAGATGGGCGATGGACTTTTGAGAGAGATGCGAGCCAGT
TTGACGGTCGAGAGCGAGGACTTCTGGGGAAGTACCTGGTACATCTCGTTGTTAGGTGTACACTTCCCAGACACC
GGAAGTATCGTTTTGACTACTTCCAGTGAGAAATTTGGCGGCATCTTCTCGTTGCCGCATTTCATGCTATCTTCT
GACACTTACGAATTGTCACACGAGCTTCTTCTCAAGTCACTGTCGGACACCATCTCGGAGAAGCAAAATCGACCC
CCAACACTGTTCCCCTGGTCCTCTCTGACAGGAACAGAGCAGATGGAGTTCCCTGCGCCTAAATGTGAACATATC
ATCTACTTGCAGCAGCATCCAGTCATGCTCGAAGATGCCGTTGCTGACCGATTGTTATTGGAGCGTATGGAGCAA
GAGCTCAGATATCCTATGGGAGCGCCAATCCCAGATCCTCCTCTTATGGTCATGTCTGCTGTTGTCTTCTCCCCA
GACTGCGGGTACATACTTCAAACGAAAGGAACCCCTGAGTTTCCTCCTTCTGATGCATTATATGTGACTGGGCCT
AAGCATGAAGAGTACAGTAAATATGCATCTCGTCTCATTTTTGTGGTTTCTGGTGTTTTTGTTGCACAGATCACC
CTGCTTCTTCGACAGATCAAAGAGGCTTCGACTCCTTCTACCCGGAGTCGGATCAGCTTCTATACCATCGCATTG
ATGGCGCTCGGCGATGCATTTGTTTTGACATTCATTGTTTTGGAACTATATGCCGCAGTATCTTTCCTAGTTTTG
GCTACTGCATCATTTTTGGCGTTCCTGTCGGTGAGTTATATTGGAATGAAGTTCATGATGGAAATATGGGCAGTG
CAAGAGCCAGAAAGAAGAGAGCAAGATCGTCCGCCCAATCCATCAACTCCAACAACTCGCCCTGGAACTTTGCCT
TTGCCTGCCACTGCTTCGGAAGCACGAGACTCGGGAGCGACCCCAATCATCTTGTCACCCGACCAAGATGCCCCC
GACGATGAGATGGATTCGCCGCCGCCAACCACCCGAGCCACTCCCCCAACTCCAAGGCAAATCCGCAGCGACGTA
GGAACAATGTACGCACGGTTCTATCTTACCCTATTTGGCATGCTCATCCTGTCAATCTGGGCTTTCCTCCTGCCG
AGACGTCTCGGCTCAATATACACCCGCTTCTTGGCAGCAGTCTATCTCTCCTTCTGGGTTCCACAGGTCTACCGC
AACGCGATGAGAAATTGCCGCAAGGCTCTTCGGTGGGACTTTGTTGCCGGCCAAAGTGTTCTGCGACTCTTCCCA
TTCTTGTACTTCCTCACGGCACGGGGAAACGTGTTGTTTATCCGCCCCGACTATACAAGCGCATTCATCATGACT
GGATGGGTGTGGATTCAAGCATGGATCCTGGTCAGCCAGGACGTTCTCGGGCCACGCTTCTTTGTGCCTCGTGGC
TGGGCACCGCATGCATACGATTACCATCCCATGCTGCGCGATTTATCCGGAGCGGACGAGGATCTCGAAGCCGGT
GGTGGCGTTCTGTCGATTGCATCCCTGCGCGGTGATGAACGAGATCTAGTCAGTGATTCGAAGGATGATGATAAG
CAGCGGAAAGACCGCAAGAAGGCCATATTCGACTGTGCTATTTGCATGCAGGATATCGAGGTTCCTGTCCTTCCC
GCGCCTTCTGCTTCGGGTGGAAGTAGCGTCACCGATGGGGCCGCAAGCATCTTGAGTCGCCGGCTATATATGGTC
ACTCCTTGTCGTCATATATTCCACACTGCCTGTCTGGAAAGCTGGATGAGACTTCGCCTCCAATGTCCGATCTGT
CGTGAATCCATACCTCCTGTATAA
Transcript >Pro_DTO377G3_2|g2534.t1
ATGGATAACCGCGGCTCCTTTTTCTTCTTCGTGCTGGTGTTCTACCTTCTCTTCAGTTCCCAGTCTCGACCGCCA
TTGATCGATGAAGATCGGGCACGGCAACGTGAGCTTGACCATGAGCGACAGGTCCTTCGGTTATTGAATGGATCA
AAATATGGCGACTTCGATCCGCCCGCCAATCGATGGCTTCCTTTTTCGGGTTCAAGAGGGAATGACAGCTATGCT
TGGGACCTTTTTCCGCAGGTCAAAGGCCTGGCTCGCCACCAGTTACAATCAGCGGTCTCAAATGCCGGGCTAGAA
TCCCCGGACGGTCTAGAAGACCCCATTGTCTCGCCTACTTTGAACTTGACCAAGCTTCTGCTTCCGATATATCGC
AACTCAACCGGGAAGCTGCGGGGGGACTGGGTTCGGCGAACTGAAGGTGTTCATCGCCGTGAACCTCTGAACACG
ACAGCCATCGCTGAAGAACACGAATACTTTACTCATGAATTCAGTCATAATATCACTGGCAATAGCGGCACCTTT
TACTTTGATCTTGAAGAGGGAGGTGGTGAAGAACTTCAGATGGGCGATGGACTTTTGAGAGAGATGCGAGCCAGT
TTGACGGTCGAGAGCGAGGACTTCTGGGGAAGTACCTGGTACATCTCGTTGTTAGGTGTACACTTCCCAGACACC
GGAAGTATCGTTTTGACTACTTCCAGTGAGAAATTTGGCGGCATCTTCTCGTTGCCGCATTTCATGCTATCTTCT
GACACTTACGAATTGTCACACGAGCTTCTTCTCAAGTCACTGTCGGACACCATCTCGGAGAAGCAAAATCGACCC
CCAACACTGTTCCCCTGGTCCTCTCTGACAGGAACAGAGCAGATGGAGTTCCCTGCGCCTAAATGTGAACATATC
ATCTACTTGCAGCAGCATCCAGTCATGCTCGAAGATGCCGTTGCTGACCGATTGTTATTGGAGCGTATGGAGCAA
GAGCTCAGATATCCTATGGGAGCGCCAATCCCAGATCCTCCTCTTATGGTCATGTCTGCTGTTGTCTTCTCCCCA
GACTGCGGGTACATACTTCAAACGAAAGGAACCCCTGAGTTTCCTCCTTCTGATGCATTATATGTGACTGGGCCT
AAGCATGAAGAGTACAGTAAATATGCATCTCGTCTCATTTTTGTGGTTTCTGGTGTTTTTGTTGCACAGATCACC
CTGCTTCTTCGACAGATCAAAGAGGCTTCGACTCCTTCTACCCGGAGTCGGATCAGCTTCTATACCATCGCATTG
ATGGCGCTCGGCGATGCATTTGTTTTGACATTCATTGTTTTGGAACTATATGCCGCAGTATCTTTCCTAGTTTTG
GCTACTGCATCATTTTTGGCGTTCCTGTCGGTGAGTTATATTGGAATGAAGTTCATGATGGAAATATGGGCAGTG
CAAGAGCCAGAAAGAAGAGAGCAAGATCGTCCGCCCAATCCATCAACTCCAACAACTCGCCCTGGAACTTTGCCT
TTGCCTGCCACTGCTTCGGAAGCACGAGACTCGGGAGCGACCCCAATCATCTTGTCACCCGACCAAGATGCCCCC
GACGATGAGATGGATTCGCCGCCGCCAACCACCCGAGCCACTCCCCCAACTCCAAGGCAAATCCGCAGCGACGTA
GGAACAATGTACGCACGGTTCTATCTTACCCTATTTGGCATGCTCATCCTGTCAATCTGGGCTTTCCTCCTGCCG
AGACGTCTCGGCTCAATATACACCCGCTTCTTGGCAGCAGTCTATCTCTCCTTCTGGGTTCCACAGGTCTACCGC
AACGCGATGAGAAATTGCCGCAAGGCTCTTCGGTGGGACTTTGTTGCCGGCCAAAGTGTTCTGCGACTCTTCCCA
TTCTTGTACTTCCTCACGGCACGGGGAAACGTGTTGTTTATCCGCCCCGACTATACAAGCGCATTCATCATGACT
GGATGGGTGTGGATTCAAGCATGGATCCTGGTCAGCCAGGACGTTCTCGGGCCACGCTTCTTTGTGCCTCGTGGC
TGGGCACCGCATGCATACGATTACCATCCCATGCTGCGCGATTTATCCGGAGCGGACGAGGATCTCGAAGCCGGT
GGTGGCGTTCTGTCGATTGCATCCCTGCGCGGTGATGAACGAGATCTAGTCAGTGATTCGAAGGATGATGATAAG
CAGCGGAAAGACCGCAAGAAGGCCATATTCGACTGTGCTATTTGCATGCAGGATATCGAGGTTCCTGTCCTTCCC
GCGCCTTCTGCTTCGGGTGGAAGTAGCGTCACCGATGGGGCCGCAAGCATCTTGAGTCGCCGGCTATATATGGTC
ACTCCTTGTCGTCATATATTCCACACTGCCTGTCTGGAAAGCTGGATGAGACTTCGCCTCCAATGTCCGATCTGT
CGTGAATCCATACCTCCTGTATAA
Gene >Pro_DTO377G3_2|g2534.t1
ATGGATAACCGCGGCTCCTTTTTCTTCTTCGTGCTGGTGTTCTACCTTCTCTTCAGTTCCCAGTCTCGACCGCCA
TTGATCGATGAAGATCGGGCACGGCAACGTGAGCTTGACCATGAGCGACAGGTCCTTCGGTTATTGAATGGATCA
AAATATGGCGACTTCGATCCGCCCGCCAATCGATGGCTTCCTTTTTCGGGTTCAAGAGGGAATGACAGCTATGCT
TGGGACCTTTTTCCGCAGGTCAAAGGCCTGGCTCGCCACCAGTTACAATCAGCGGTCTCAAATGCCGGGCTAGAA
TCCCCGGACGGTCTAGAAGACCCCATTGTCTCGCCTACTTTGAACTTGACCAAGCTTCTGCTTCCGATATATCGC
AACTCAACCGGGAAGCTGCGGGGGGACTGGGTTCGGCGAACTGAAGGTGTTCATCGCCGTGAACCTCTGAACACG
ACAGCCATCGCTGAAGAACACGAATACTTTACTCATGAATTCAGTCATAATATCACTGGCAATAGCGGCACCTTT
TACTTTGATCTTGAAGAGGGAGGTGGTGAAGAACTTCAGATGGGCGATGGACTTTTGAGAGAGATGCGAGCCAGT
TTGACGGTCGAGAGCGAGGACTTCTGGGGAAGTACCTGGTACATCTCGTTGTTAGGTGTACACTTCCCAGACACC
GGAAGTATCGTTTTGACTACTTCCAGTGAGAAATTTGGCGGCATCTTCTCGTTGCCGCATTTCATGCTATCTTCT
GACACTTACGAATTGTCACACGAGCTTCTTCTCAAGTCACTGTCGGACACCATCTCGGAGAAGCAAAATCGACCC
CCAACACTGTTCCCCTGGTCCTCTCTGACAGGAACAGAGCAGATGGAGTTCCCTGCGCCTAAATGTGAACATATC
ATCTACTTGCAGCAGCATCCAGTCATGCTCGAAGATGCCGTTGCTGACCGATTGTTATTGGAGCGTATGGAGCAA
GAGCTCAGATATCCTATGGGAGCGCCAATCCCAGATCCTCCTCTTATGGTCATGTCTGCTGTTGTCTTCTCCCCA
GACTGCGGGTACATACTTCAAACGAAAGGAACCCCTGAGTTTCCTCCTTCTGATGCATTATATGTGACTGGGCCT
AAGCATGAAGAGTACAGTAAATATGCATCTCGTCTCATTTTTGTGGTTTCTGGTGTTTTTGTTGCACAGATCACC
CTGCTTCTTCGACAGATCAAAGAGGCTTCGACTCCTTCTACCCGGAGTCGGATCAGCTTCTATACCATCGCATTG
ATGGCGCTCGGCGATGCATTTGTTTTGACATTCATTGTTTTGGAACTATATGCCGCAGTATCTTTCCTAGTTTTG
GCTACTGCATCATTTTTGGCGTTCCTGTCGGTGAGTTATATTGGAATGAAGTTCATGATGGAAATATGGGCAGTG
CAAGAGCCAGAAAGAAGAGAGCAAGATCGTCCGCCCAATCCATCAACTCCAACAACTCGCCCTGGAACTTTGCCT
TTGCCTGCCACTGCTTCGGAAGCACGAGACTCGGGAGCGACCCCAATCATCTTGTCACCCGACCAAGATGCCCCC
GACGATGAGATGGATTCGCCGCCGCCAACCACCCGAGCCACTCCCCCAACTCCAAGGCAAATCCGCAGCGACGTA
GGAACAATGTACGCACGGTTCTATCTTACCCTATTTGGCATGCTCATCCTGTCAATCTGGGCTTTCCTCCTGCCG
AGACGTCTCGGCTCAATATACACCCGCTTCTTGGCAGCAGTCTATCTCTCCTTCTGGGTTCCACAGGTCTACCGC
AACGCGATGAGAAATTGCCGCAAGGCTCTTCGGTGGGACTTTGTTGCCGGCCAAAGTGTTCTGCGACTCTTCCCA
TTCTTGTACTTCCTCACGGCACGGGGAAACGTGTTGTTTATCCGCCCCGACTATACAAGCGCATTCATCATGACT
GGATGGGTGTGGATTCAAGCATGGATCCTGGTCAGCCAGGACGTTCTCGGGCCACGCTTCTTTGTGCCTCGTGGC
TGGGCACCGCATGCATACGATTACCATCCCATGCTGCGCGATTTATCCGGAGCGGACGAGGATCTCGAAGCCGGT
GGTGGCGTTCTGTCGATTGCATCCCTGCGCGGTGATGAACGAGATCTAGTCAGTGATTCGAAGGATGATGATAAG
CAGCGGAAAGACCGCAAGAAGGCCATATTCGACTGTGCTATTTGCATGCAGGATATCGAGGTTCCTGTCCTTCCC
GCGCCTTCTGCTTCGGGTGGAAGTAGCGTCACCGATGGGGCCGCAAGCATCTTGAGTCGCCGGCTATATATGGTC
ACTCCTTGTCGTCATATATTCCACACTGCCTGTCTGGAAAGCTGGATGAGACTTCGCCTCCAATGTCCGATCTGT
CGTGAATCCATACCTCCTGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail