Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2520.t1
Gene name
Locationscaffold_03:237439..238886
Strand+
Gene length (bp)1447
Transcript length (bp)1383
Coding sequence length (bp)1383
Protein length (aa) 461

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01545 Cation_efflux Cation efflux family 1.3E-13 165 371

GO

GO Term Description Terminal node
GO:0006812 cation transport Yes
GO:0055085 transmembrane transport Yes
GO:0008324 cation transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0015075 ion transmembrane transporter activity No
GO:0044425 membrane part No
GO:0006810 transport No
GO:0005575 cellular_component No
GO:0022857 transmembrane transporter activity No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0006811 ion transport No
GO:0031224 intrinsic component of membrane No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

Domain # Start End Length
1 159 178 19
2 188 210 22
3 227 249 22
4 269 291 22
5 312 334 22
6 349 371 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2520.t1
MASNLPLPLPPRTPTPPADDEHASQINSGIPIDRNSLSPLKASFTKGIMDAEIRNTLSPTKSSFNLATSPEDAET
PIENGLGDTSAGPFNFNTTVMAKSPVIKSNMGQRRGHKYKHSSISHQIFLEPPPRAPLALPNSLPMPTLKECRSS
MSKEQKTRFWWSVCHMFIAAYTLWTAHGSLAMTALSHLILFDSLGALLCVAVDVLGNFEVWKRSTIRHPFGLERA
EVLAGFAMAVLLLFMGMDLISHNLQHFLEKAGHEPHHPHDHDRISLGSVDVTAILAISSTLVSAIGLKNHARIGK
AMRFGYIESLPSVLSNPSHFLTLSCSALLLLLPLVSIRIYDWLDKLLSGTIAFSMCFLGTRLVKTLGSMLLMSYS
GQGVSDVIKDIEADAAVFGIDDARFWQVHYGLCMANLKLRVNGSEDNLVRLREKISSLIRNRLGGGYGTGGQRWE
VSLQFTIERT*
Coding >Pro_DTO377G3_2|g2520.t1
ATGGCTTCGAATCTTCCTCTCCCTCTCCCCCCGCGCACCCCCACTCCACCAGCGGACGACGAACATGCCTCCCAG
ATCAACTCGGGGATACCCATCGATCGCAATTCCCTATCACCGCTTAAGGCTTCCTTTACAAAGGGTATCATGGAC
GCCGAAATCAGAAATACTCTGAGCCCCACAAAGTCTTCTTTCAATCTAGCAACCTCGCCTGAAGATGCAGAGACG
CCGATCGAGAATGGCTTGGGCGACACATCCGCCGGGCCATTCAATTTCAATACTACTGTAATGGCGAAGAGCCCA
GTGATCAAATCGAACATGGGACAACGTCGTGGCCACAAGTACAAGCACAGTAGCATCTCGCACCAGATCTTCCTC
GAGCCTCCTCCTCGCGCGCCCCTAGCCCTTCCGAACTCCTTGCCCATGCCAACACTGAAAGAATGCCGATCTAGC
ATGTCGAAGGAACAAAAGACCCGCTTCTGGTGGAGTGTGTGCCATATGTTCATTGCGGCATACACGCTCTGGACC
GCACATGGATCCTTGGCCATGACAGCACTGTCACATCTGATTCTATTTGACTCACTCGGGGCTCTATTATGTGTT
GCGGTAGATGTGCTTGGCAATTTTGAAGTTTGGAAGAGATCAACTATCCGCCACCCGTTTGGCCTTGAACGTGCA
GAAGTTTTAGCCGGATTCGCTATGGCTGTGCTTCTTTTATTTATGGGGATGGATCTAATCTCCCATAATTTGCAG
CATTTCCTCGAGAAGGCTGGTCATGAGCCTCATCACCCCCATGACCATGATCGGATTTCTCTGGGTAGTGTGGAT
GTGACTGCAATTCTAGCTATCTCATCAACGCTCGTGTCAGCCATTGGTCTCAAGAACCACGCTCGAATCGGTAAG
GCTATGCGATTTGGGTACATCGAATCTCTTCCATCGGTCTTGAGCAACCCGTCCCACTTTCTCACCCTCTCTTGT
TCAGCTCTGCTGCTGCTTCTACCTCTGGTCTCGATCCGGATCTATGATTGGCTCGATAAGCTCTTATCTGGTACC
ATTGCATTCTCAATGTGCTTCCTGGGAACTCGCTTGGTGAAAACTCTAGGCTCCATGCTTCTCATGTCCTACTCC
GGCCAAGGAGTTTCTGATGTTATCAAGGATATTGAAGCCGACGCTGCTGTGTTCGGCATTGACGACGCTCGATTC
TGGCAGGTCCATTATGGGCTGTGCATGGCAAACCTCAAGCTCCGAGTCAACGGATCTGAGGATAATCTTGTCCGG
CTACGGGAGAAGATATCTAGCTTGATTCGCAACAGGCTAGGTGGTGGGTATGGCACCGGGGGTCAAAGATGGGAG
GTGTCTTTGCAATTCACGATTGAGCGTACATGA
Transcript >Pro_DTO377G3_2|g2520.t1
ATGGCTTCGAATCTTCCTCTCCCTCTCCCCCCGCGCACCCCCACTCCACCAGCGGACGACGAACATGCCTCCCAG
ATCAACTCGGGGATACCCATCGATCGCAATTCCCTATCACCGCTTAAGGCTTCCTTTACAAAGGGTATCATGGAC
GCCGAAATCAGAAATACTCTGAGCCCCACAAAGTCTTCTTTCAATCTAGCAACCTCGCCTGAAGATGCAGAGACG
CCGATCGAGAATGGCTTGGGCGACACATCCGCCGGGCCATTCAATTTCAATACTACTGTAATGGCGAAGAGCCCA
GTGATCAAATCGAACATGGGACAACGTCGTGGCCACAAGTACAAGCACAGTAGCATCTCGCACCAGATCTTCCTC
GAGCCTCCTCCTCGCGCGCCCCTAGCCCTTCCGAACTCCTTGCCCATGCCAACACTGAAAGAATGCCGATCTAGC
ATGTCGAAGGAACAAAAGACCCGCTTCTGGTGGAGTGTGTGCCATATGTTCATTGCGGCATACACGCTCTGGACC
GCACATGGATCCTTGGCCATGACAGCACTGTCACATCTGATTCTATTTGACTCACTCGGGGCTCTATTATGTGTT
GCGGTAGATGTGCTTGGCAATTTTGAAGTTTGGAAGAGATCAACTATCCGCCACCCGTTTGGCCTTGAACGTGCA
GAAGTTTTAGCCGGATTCGCTATGGCTGTGCTTCTTTTATTTATGGGGATGGATCTAATCTCCCATAATTTGCAG
CATTTCCTCGAGAAGGCTGGTCATGAGCCTCATCACCCCCATGACCATGATCGGATTTCTCTGGGTAGTGTGGAT
GTGACTGCAATTCTAGCTATCTCATCAACGCTCGTGTCAGCCATTGGTCTCAAGAACCACGCTCGAATCGGTAAG
GCTATGCGATTTGGGTACATCGAATCTCTTCCATCGGTCTTGAGCAACCCGTCCCACTTTCTCACCCTCTCTTGT
TCAGCTCTGCTGCTGCTTCTACCTCTGGTCTCGATCCGGATCTATGATTGGCTCGATAAGCTCTTATCTGGTACC
ATTGCATTCTCAATGTGCTTCCTGGGAACTCGCTTGGTGAAAACTCTAGGCTCCATGCTTCTCATGTCCTACTCC
GGCCAAGGAGTTTCTGATGTTATCAAGGATATTGAAGCCGACGCTGCTGTGTTCGGCATTGACGACGCTCGATTC
TGGCAGGTCCATTATGGGCTGTGCATGGCAAACCTCAAGCTCCGAGTCAACGGATCTGAGGATAATCTTGTCCGG
CTACGGGAGAAGATATCTAGCTTGATTCGCAACAGGCTAGGTGGTGGGTATGGCACCGGGGGTCAAAGATGGGAG
GTGTCTTTGCAATTCACGATTGAGCGTACATGA
Gene >Pro_DTO377G3_2|g2520.t1
ATGGCTTCGAATCTTCCTCTCCCTCTCCCCCCGCGCACCCCCACTCCACCAGCGGACGACGAACATGCCTCCCAG
ATCAACTCGGGGATACCCATCGATCGCAATTCCCTATCACCGCTTAAGGCTTCCTTTACAAAGGGTATCATGGAC
GCCGAAATCAGAAATACTCTGAGCCCCACAAAGTCTTCTTTCAATCTAGCAACCTCGCCTGAAGATGCAGAGACG
CCGATCGAGAATGGCTTGGGCGACACATCCGCCGGGCCATTCAATTTCAATACTACTGTAATGGCGAAGAGCCCA
GTGATCAAATCGGTGAGTTGAATTGCGCTGATGACCTGTGACGACGGCATTGTTAACTTATTCCCTCGTGTTTCA
GAACATGGGACAACGTCGTGGCCACAAGTACAAGCACAGTAGCATCTCGCACCAGATCTTCCTCGAGCCTCCTCC
TCGCGCGCCCCTAGCCCTTCCGAACTCCTTGCCCATGCCAACACTGAAAGAATGCCGATCTAGCATGTCGAAGGA
ACAAAAGACCCGCTTCTGGTGGAGTGTGTGCCATATGTTCATTGCGGCATACACGCTCTGGACCGCACATGGATC
CTTGGCCATGACAGCACTGTCACATCTGATTCTATTTGACTCACTCGGGGCTCTATTATGTGTTGCGGTAGATGT
GCTTGGCAATTTTGAAGTTTGGAAGAGATCAACTATCCGCCACCCGTTTGGCCTTGAACGTGCAGAAGTTTTAGC
CGGATTCGCTATGGCTGTGCTTCTTTTATTTATGGGGATGGATCTAATCTCCCATAATTTGCAGCATTTCCTCGA
GAAGGCTGGTCATGAGCCTCATCACCCCCATGACCATGATCGGATTTCTCTGGGTAGTGTGGATGTGACTGCAAT
TCTAGCTATCTCATCAACGCTCGTGTCAGCCATTGGTCTCAAGAACCACGCTCGAATCGGTAAGGCTATGCGATT
TGGGTACATCGAATCTCTTCCATCGGTCTTGAGCAACCCGTCCCACTTTCTCACCCTCTCTTGTTCAGCTCTGCT
GCTGCTTCTACCTCTGGTCTCGATCCGGATCTATGATTGGCTCGATAAGCTCTTATCTGGTACCATTGCATTCTC
AATGTGCTTCCTGGGAACTCGCTTGGTGAAAACTCTAGGCTCCATGCTTCTCATGTCCTACTCCGGCCAAGGAGT
TTCTGATGTTATCAAGGATATTGAAGCCGACGCTGCTGTGTTCGGCATTGACGACGCTCGATTCTGGCAGGTCCA
TTATGGGCTGTGCATGGCAAACCTCAAGCTCCGAGTCAACGGATCTGAGGATAATCTTGTCCGGCTACGGGAGAA
GATATCTAGCTTGATTCGCAACAGGCTAGGTGGTGGGTATGGCACCGGGGGTCAAAGATGGGAGGTGTCTTTGCA
ATTCACGATTGAGCGTACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail