Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2510.t1
Gene name
Locationscaffold_03:214020..215231
Strand-
Gene length (bp)1211
Transcript length (bp)1152
Coding sequence length (bp)1152
Protein length (aa) 384

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 4.4E-08 242 306

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 62.39 36.88 87.91
5d_25C Five days - 25 degrees Celsius 66.41 39.48 93.34
7d_25C Seven days - 25 degrees Celsius 68.52 40.80 96.23
10d_25C Ten days - 25 degrees Celsius 76.70 46.01 107.40
7d_15C Seven days - 15 degrees Celsius 52.80 30.58 75.02
7d_30C Seven days - 30 degrees Celsius 57.22 33.51 80.93

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.848061 no
3d_25C 7d_25C 0.761878 no
3d_25C 7d_15C 0.551834 no
3d_25C 7d_30C 0.782899 no
3d_25C 10d_25C 0.429088 no
5d_25C 7d_25C 0.928643 no
5d_25C 7d_15C 0.368155 no
5d_25C 7d_30C 0.584770 no
5d_25C 10d_25C 0.605089 no
7d_25C 7d_15C 0.283987 no
7d_25C 7d_30C 0.490324 no
7d_25C 10d_25C 0.697711 no
7d_15C 7d_30C 0.804108 no
7d_15C 10d_25C 0.105537 no
7d_30C 10d_25C 0.216342 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2510.t1
MPPQIKHDLNRSGWESTDFPSVCENCLPENPYVQMIKEDHGAECKICTRPFTIFRWKADRTSRQKRSIICLTCAR
LKNCCQCCMLDLSFGLPLAVRDAALKMVAPGPESSINREYYAQNNEKEIEEGRGAIEEYEKTDDKARELLRRLAN
SEPYYRKPRRIEAPAEEEKAEEGTATDQPRTNSRYGNGPGPVRTSESRAGNRLPGRGGRGGGRGGRPFPSTTQLP
PSAADILPPKDPNVTSLFITGVEDDLPEHALRTFFSEFGQLRSLICSHRSHCAFINYVNRADAETAANHCQGKAI
IQGCPLRVRWGKPKPLDNLDREERMQNAREGRQTVASVAKGKQADRQAITSAGEGASQEKAQPHVIAPPPGSGEI
QYASMNGD*
Coding >Pro_DTO377G3_2|g2510.t1
ATGCCTCCTCAAATCAAGCATGATTTGAATCGATCCGGCTGGGAGTCGACAGACTTTCCCTCCGTTTGTGAGAAC
TGCCTTCCCGAAAATCCATACGTGCAGATGATCAAGGAAGATCATGGCGCAGAGTGCAAGATCTGCACGCGACCA
TTTACTATCTTCCGTTGGAAGGCCGATCGGACCTCCCGCCAAAAGCGATCCATTATCTGTCTCACATGCGCGCGC
CTGAAGAACTGCTGTCAATGCTGCATGCTAGATTTGTCTTTCGGTCTTCCCCTTGCCGTCCGTGATGCTGCTCTC
AAAATGGTCGCCCCAGGACCGGAAAGCTCCATCAATCGCGAGTATTACGCGCAGAACAACGAGAAGGAAATCGAA
GAGGGACGCGGCGCTATTGAAGAATACGAAAAGACAGACGACAAGGCTCGTGAGCTTTTGCGACGCCTTGCAAAC
AGCGAACCGTATTACCGCAAACCCAGACGAATCGAAGCACCTGCCGAGGAGGAGAAAGCGGAGGAAGGCACGGCG
ACAGATCAACCACGAACAAACAGTCGGTATGGAAATGGACCAGGTCCGGTTCGCACCAGTGAAAGCCGCGCCGGA
AACCGCCTTCCAGGCCGGGGAGGACGAGGTGGTGGCCGTGGTGGCCGCCCATTCCCCAGTACCACCCAATTACCG
CCATCGGCTGCAGATATTCTTCCCCCTAAGGATCCCAACGTCACTTCCTTGTTTATTACAGGCGTGGAAGACGAT
CTCCCTGAACATGCGCTTCGCACATTTTTTAGCGAATTCGGCCAGCTCCGGTCGCTTATTTGCTCCCACCGCTCC
CATTGTGCTTTCATCAACTACGTCAACCGTGCGGATGCCGAAACCGCCGCCAACCACTGCCAAGGCAAGGCCATC
ATTCAGGGCTGCCCTCTACGTGTTCGCTGGGGAAAGCCGAAGCCACTGGATAATTTGGACCGTGAAGAGAGAATG
CAAAATGCCCGCGAGGGTCGCCAGACCGTGGCATCGGTTGCCAAGGGTAAGCAAGCAGATCGACAAGCCATTACC
TCTGCAGGCGAGGGTGCTAGCCAGGAGAAAGCTCAGCCTCATGTTATTGCACCACCGCCCGGATCGGGTGAGATC
CAATATGCCAGCATGAATGGCGATTGA
Transcript >Pro_DTO377G3_2|g2510.t1
ATGCCTCCTCAAATCAAGCATGATTTGAATCGATCCGGCTGGGAGTCGACAGACTTTCCCTCCGTTTGTGAGAAC
TGCCTTCCCGAAAATCCATACGTGCAGATGATCAAGGAAGATCATGGCGCAGAGTGCAAGATCTGCACGCGACCA
TTTACTATCTTCCGTTGGAAGGCCGATCGGACCTCCCGCCAAAAGCGATCCATTATCTGTCTCACATGCGCGCGC
CTGAAGAACTGCTGTCAATGCTGCATGCTAGATTTGTCTTTCGGTCTTCCCCTTGCCGTCCGTGATGCTGCTCTC
AAAATGGTCGCCCCAGGACCGGAAAGCTCCATCAATCGCGAGTATTACGCGCAGAACAACGAGAAGGAAATCGAA
GAGGGACGCGGCGCTATTGAAGAATACGAAAAGACAGACGACAAGGCTCGTGAGCTTTTGCGACGCCTTGCAAAC
AGCGAACCGTATTACCGCAAACCCAGACGAATCGAAGCACCTGCCGAGGAGGAGAAAGCGGAGGAAGGCACGGCG
ACAGATCAACCACGAACAAACAGTCGGTATGGAAATGGACCAGGTCCGGTTCGCACCAGTGAAAGCCGCGCCGGA
AACCGCCTTCCAGGCCGGGGAGGACGAGGTGGTGGCCGTGGTGGCCGCCCATTCCCCAGTACCACCCAATTACCG
CCATCGGCTGCAGATATTCTTCCCCCTAAGGATCCCAACGTCACTTCCTTGTTTATTACAGGCGTGGAAGACGAT
CTCCCTGAACATGCGCTTCGCACATTTTTTAGCGAATTCGGCCAGCTCCGGTCGCTTATTTGCTCCCACCGCTCC
CATTGTGCTTTCATCAACTACGTCAACCGTGCGGATGCCGAAACCGCCGCCAACCACTGCCAAGGCAAGGCCATC
ATTCAGGGCTGCCCTCTACGTGTTCGCTGGGGAAAGCCGAAGCCACTGGATAATTTGGACCGTGAAGAGAGAATG
CAAAATGCCCGCGAGGGTCGCCAGACCGTGGCATCGGTTGCCAAGGGTAAGCAAGCAGATCGACAAGCCATTACC
TCTGCAGGCGAGGGTGCTAGCCAGGAGAAAGCTCAGCCTCATGTTATTGCACCACCGCCCGGATCGGGTGAGATC
CAATATGCCAGCATGAATGGCGATTGA
Gene >Pro_DTO377G3_2|g2510.t1
ATGCCTCCTCAAATCAAGCATGATTTGAATCGATCCGGCTGGGAGTCGACAGACTTTCCCTCCGTTTGTGAGAAC
TGCCTTCCCGAAAATCCATACGTGCAGATGATCAAGGAAGATCATGGCGCAGAGTGCAAGATCGTAAGTCTTTTT
TTTCTGCTCCCCCGAGGCTAGTTCATAACCACATACTAAATATTTAGTGCACGCGACCATTTACTATCTTCCGTT
GGAAGGCCGATCGGACCTCCCGCCAAAAGCGATCCATTATCTGTCTCACATGCGCGCGCCTGAAGAACTGCTGTC
AATGCTGCATGCTAGATTTGTCTTTCGGTCTTCCCCTTGCCGTCCGTGATGCTGCTCTCAAAATGGTCGCCCCAG
GACCGGAAAGCTCCATCAATCGCGAGTATTACGCGCAGAACAACGAGAAGGAAATCGAAGAGGGACGCGGCGCTA
TTGAAGAATACGAAAAGACAGACGACAAGGCTCGTGAGCTTTTGCGACGCCTTGCAAACAGCGAACCGTATTACC
GCAAACCCAGACGAATCGAAGCACCTGCCGAGGAGGAGAAAGCGGAGGAAGGCACGGCGACAGATCAACCACGAA
CAAACAGTCGGTATGGAAATGGACCAGGTCCGGTTCGCACCAGTGAAAGCCGCGCCGGAAACCGCCTTCCAGGCC
GGGGAGGACGAGGTGGTGGCCGTGGTGGCCGCCCATTCCCCAGTACCACCCAATTACCGCCATCGGCTGCAGATA
TTCTTCCCCCTAAGGATCCCAACGTCACTTCCTTGTTTATTACAGGCGTGGAAGACGATCTCCCTGAACATGCGC
TTCGCACATTTTTTAGCGAATTCGGCCAGCTCCGGTCGCTTATTTGCTCCCACCGCTCCCATTGTGCTTTCATCA
ACTACGTCAACCGTGCGGATGCCGAAACCGCCGCCAACCACTGCCAAGGCAAGGCCATCATTCAGGGCTGCCCTC
TACGTGTTCGCTGGGGAAAGCCGAAGCCACTGGATAATTTGGACCGTGAAGAGAGAATGCAAAATGCCCGCGAGG
GTCGCCAGACCGTGGCATCGGTTGCCAAGGGTAAGCAAGCAGATCGACAAGCCATTACCTCTGCAGGCGAGGGTG
CTAGCCAGGAGAAAGCTCAGCCTCATGTTATTGCACCACCGCCCGGATCGGGTGAGATCCAATATGCCAGCATGA
ATGGCGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail