Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g25.t1
Gene name
Locationscaffold_01:64091..64808
Strand-
Gene length (bp)717
Transcript length (bp)540
Coding sequence length (bp)540
Protein length (aa) 180

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 52 74 22
3 81 103 22
4 152 174 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 14.64 3.98 25.31
5d_25C Five days - 25 degrees Celsius 11.22 2.85 19.58
7d_25C Seven days - 25 degrees Celsius 10.19 2.15 18.23
10d_25C Ten days - 25 degrees Celsius 5.87 0.80 10.95
7d_15C Seven days - 15 degrees Celsius 12.17 2.84 21.49
7d_30C Seven days - 30 degrees Celsius 14.00 3.70 24.30

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.595907 no
3d_25C 7d_25C 0.456096 no
3d_25C 7d_15C 0.742736 no
3d_25C 7d_30C 0.945229 no
3d_25C 10d_25C 0.035243 yes
5d_25C 7d_25C 0.878727 no
5d_25C 7d_15C 0.901313 no
5d_25C 7d_30C 0.665276 no
5d_25C 10d_25C 0.157727 no
7d_25C 7d_15C 0.764122 no
7d_25C 7d_30C 0.522791 no
7d_25C 10d_25C 0.263767 no
7d_15C 7d_30C 0.809956 no
7d_15C 10d_25C 0.119073 no
7d_30C 10d_25C 0.041603 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g25.t1
MAVRRRREMRRRYHWPELQLNIWIMVVLSCAATCLGIFSWFMTVQSQMHLGTPWLFPYMVVSSALGVCFIFLIMI
LAARHFLLPGIIIIGSFILFVLWLTGLIETSLQLYGVVGNVNDNCQIYVTNNKAWGNNINTLAWLTQSTICNCWR
TAFALELVNTIFYLWMMIMSWQVNRDVYD*
Coding >Pro_DTO377G3_2|g25.t1
ATGGCAGTCCGCAGGCGTCGCGAAATGCGCCGCCGCTACCACTGGCCCGAACTCCAACTCAACATCTGGATTATG
GTTGTGCTATCGTGCGCAGCGACATGTCTGGGGATATTCTCGTGGTTCATGACCGTGCAATCACAAATGCATCTT
GGGACGCCATGGCTCTTCCCTTACATGGTCGTCAGCAGCGCACTCGGCGTGTGCTTCATATTCCTAATTATGATC
CTTGCAGCGCGCCACTTCCTCTTACCGGGCATTATCATCATCGGCAGCTTTATTCTCTTTGTGCTGTGGCTGACG
GGTCTGATTGAGACTTCGCTGCAGCTGTATGGCGTTGTCGGGAATGTGAATGATAATTGCCAAATCTACGTGACG
AACAATAAGGCTTGGGGGAATAATATCAACACCTTGGCTTGGTTGACGCAGAGTACTATTTGCAATTGCTGGAGA
ACTGCCTTTGCGCTCGAGCTTGTGAACACGATTTTCTATCTTTGGATGATGATTATGTCGTGGCAGGTGAATCGG
GATGTTTATGATTGA
Transcript >Pro_DTO377G3_2|g25.t1
ATGGCAGTCCGCAGGCGTCGCGAAATGCGCCGCCGCTACCACTGGCCCGAACTCCAACTCAACATCTGGATTATG
GTTGTGCTATCGTGCGCAGCGACATGTCTGGGGATATTCTCGTGGTTCATGACCGTGCAATCACAAATGCATCTT
GGGACGCCATGGCTCTTCCCTTACATGGTCGTCAGCAGCGCACTCGGCGTGTGCTTCATATTCCTAATTATGATC
CTTGCAGCGCGCCACTTCCTCTTACCGGGCATTATCATCATCGGCAGCTTTATTCTCTTTGTGCTGTGGCTGACG
GGTCTGATTGAGACTTCGCTGCAGCTGTATGGCGTTGTCGGGAATGTGAATGATAATTGCCAAATCTACGTGACG
AACAATAAGGCTTGGGGGAATAATATCAACACCTTGGCTTGGTTGACGCAGAGTACTATTTGCAATTGCTGGAGA
ACTGCCTTTGCGCTCGAGCTTGTGAACACGATTTTCTATCTTTGGATGATGATTATGTCGTGGCAGGTGAATCGG
GATGTTTATGATTGA
Gene >Pro_DTO377G3_2|g25.t1
ATGGCAGTCCGCAGGCGTCGCGAAATGCGCCGCCGCTACCACTGGCCCGAACTCCAACTCAACATCTGGATTATG
GTTGTGCTATCGTGCGCAGCGACATGTCTGGGGATATTCTCGTGGTTCATGACCGTGCAATCACAAATGCATCTT
GGGACGCCATGGTAAGTGATCTATATTTATCTCTATATTATCCATTATCCGTGTGGCTACGTGCATACTCATAAC
CTACCCCCCACATTCTTCCCACATGTCATAGTCAATACAGGATCTATACTAACATCTCCAGGCTCTTCCCTTACA
TGGTCGTCAGCAGCGCACTCGGCGTGTGCTTCATATTCCTAATTATGATCCTTGCAGCGCGCCACTTCCTCTTAC
CGGGCATTATCATCATCGGCAGCTTTATTCTCTTTGTGCTGTGGCTGACGGGTCTGATTGAGACTTCGCTGCAGC
TGTATGGCGTTGTCGGGAATGTGAATGATAATTGCCAAATCTACGTGACGAACAATAAGGCTTGGGGGAATAATA
TCAACACCTTGGCTTGGTTGACGCAGAGTACTATTTGTGAGTTCTCTTCTATGCCCTCTTTTGTATGTTTTGTAT
ACTGACTTTATAGGCAATTGCTGGAGAACTGCCTTTGCGCTCGAGCTTGTGAACACGATTTTCTATCTTTGGATG
ATGATTATGTCGTGGCAGGTGAATCGGGATGTTTATGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail