Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2497.t1
Gene name
Locationscaffold_03:188153..189101
Strand+
Gene length (bp)948
Transcript length (bp)891
Coding sequence length (bp)891
Protein length (aa) 297

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00010 HLH Helix-loop-helix DNA-binding domain 1.2E-09 205 264

GO

GO Term Description Terminal node
GO:0046983 protein dimerization activity Yes
GO:0005488 binding No
GO:0005515 protein binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Helix-loop-helix

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 384.14 226.54 541.73
5d_25C Five days - 25 degrees Celsius 238.32 147.02 329.62
7d_25C Seven days - 25 degrees Celsius 135.86 83.51 188.20
10d_25C Ten days - 25 degrees Celsius 85.32 50.11 120.52
7d_15C Seven days - 15 degrees Celsius 175.69 107.52 243.86
7d_30C Seven days - 30 degrees Celsius 84.87 50.07 119.66

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.024657 yes
3d_25C 7d_25C 0.000700 yes
3d_25C 7d_15C 0.000700 yes
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.004045 yes
5d_25C 7d_15C 0.176458 no
5d_25C 7d_30C 0.000700 yes
5d_25C 10d_25C 0.000700 yes
7d_25C 7d_15C 0.280597 no
7d_25C 7d_30C 0.029538 yes
7d_25C 10d_25C 0.031095 yes
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.988129 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2497.t1
MCIMACNRSNEIPNLCIDQGTYLSQHLSPQSRPADFFERPDPLAANWSYDNAIDLFSINPSDMEPVSFDFADSLT
NIESKDLFNDPFASSGISGFSMPEDAASLSSEFESDDQTWPSAARQSIDSNAFETELTSNYTSSQPQTQSKTRSS
SASWSSSPEMKQEEIATPLPSKPTTSTSRKTRSFSRDSNHSSTGGQDPQMRNAAKRAAHNIIEKRYRTNMNAKFV
SLEQAISPSGVQKHTKVGAGSLKKSEILSNALTYIDSIQQENQALHKELAMLKQNLLPAGGIWRQTKNPRL*
Coding >Pro_DTO377G3_2|g2497.t1
ATGTGTATCATGGCTTGCAACCGATCCAATGAGATCCCCAATCTCTGCATAGACCAGGGGACCTACCTCAGCCAA
CACCTGAGTCCTCAGTCTCGACCAGCCGACTTCTTCGAAAGACCTGACCCTCTCGCTGCCAACTGGAGCTACGAC
AACGCGATTGACCTGTTCTCTATCAACCCCTCCGACATGGAGCCCGTCTCGTTCGACTTCGCCGACAGCCTCACC
AACATCGAGTCCAAGGATCTCTTCAACGACCCCTTTGCCAGCTCCGGAATCAGTGGCTTCTCCATGCCCGAGGAC
GCAGCTTCTCTCTCATCTGAGTTCGAAAGCGACGATCAAACATGGCCCTCTGCTGCCCGTCAATCCATTGACTCA
AACGCCTTCGAGACCGAGTTGACTTCAAACTACACCTCGTCTCAACCTCAAACACAGAGCAAGACTCGCTCATCT
TCAGCAAGCTGGTCATCCAGTCCAGAGATGAAGCAAGAAGAGATTGCTACTCCTCTACCCTCCAAACCCACCACA
TCCACATCCCGCAAGACCCGTAGCTTCTCCCGAGACTCCAACCACTCCTCAACCGGCGGCCAAGACCCTCAAATG
CGGAATGCAGCCAAGCGTGCCGCCCACAACATCATTGAGAAGCGCTACCGTACCAACATGAACGCCAAATTTGTT
TCTCTCGAGCAGGCCATCTCGCCCTCGGGGGTTCAAAAACATACCAAGGTTGGCGCGGGATCTCTCAAGAAGTCC
GAGATCCTCAGCAATGCCCTCACCTACATCGATAGCATTCAGCAGGAGAACCAGGCCTTGCACAAGGAGCTCGCA
ATGCTCAAGCAAAACCTGCTACCGGCGGGAGGAATCTGGCGTCAGACCAAAAACCCCCGACTTTGA
Transcript >Pro_DTO377G3_2|g2497.t1
ATGTGTATCATGGCTTGCAACCGATCCAATGAGATCCCCAATCTCTGCATAGACCAGGGGACCTACCTCAGCCAA
CACCTGAGTCCTCAGTCTCGACCAGCCGACTTCTTCGAAAGACCTGACCCTCTCGCTGCCAACTGGAGCTACGAC
AACGCGATTGACCTGTTCTCTATCAACCCCTCCGACATGGAGCCCGTCTCGTTCGACTTCGCCGACAGCCTCACC
AACATCGAGTCCAAGGATCTCTTCAACGACCCCTTTGCCAGCTCCGGAATCAGTGGCTTCTCCATGCCCGAGGAC
GCAGCTTCTCTCTCATCTGAGTTCGAAAGCGACGATCAAACATGGCCCTCTGCTGCCCGTCAATCCATTGACTCA
AACGCCTTCGAGACCGAGTTGACTTCAAACTACACCTCGTCTCAACCTCAAACACAGAGCAAGACTCGCTCATCT
TCAGCAAGCTGGTCATCCAGTCCAGAGATGAAGCAAGAAGAGATTGCTACTCCTCTACCCTCCAAACCCACCACA
TCCACATCCCGCAAGACCCGTAGCTTCTCCCGAGACTCCAACCACTCCTCAACCGGCGGCCAAGACCCTCAAATG
CGGAATGCAGCCAAGCGTGCCGCCCACAACATCATTGAGAAGCGCTACCGTACCAACATGAACGCCAAATTTGTT
TCTCTCGAGCAGGCCATCTCGCCCTCGGGGGTTCAAAAACATACCAAGGTTGGCGCGGGATCTCTCAAGAAGTCC
GAGATCCTCAGCAATGCCCTCACCTACATCGATAGCATTCAGCAGGAGAACCAGGCCTTGCACAAGGAGCTCGCA
ATGCTCAAGCAAAACCTGCTACCGGCGGGAGGAATCTGGCGTCAGACCAAAAACCCCCGACTTTGA
Gene >Pro_DTO377G3_2|g2497.t1
ATGTGTATCATGGCTTGCAACCGATCCAATGAGATCCCCAATCTCTGCATAGACCAGGGGACCTACCTCAGCCAA
CACCTGAGTCCTCAGTCTCGACCAGCCGACTTCTTCGAAAGACCTGACCCTCTCGCTGCCAACTGGAGCTACGAC
AACGCGATTGACCTGTTCTCTATCAACCCCTCCGACATGGAGCCCGTCTCGTTCGACTTCGCCGACAGCCTCACC
AACATCGAGTCCAAGGATCTCTTCAACGACCCCTTTGCCAGCTCCGGAATCAGTGGCTTCTCCATGCCCGAGGAC
GCAGCTTCTCTCTCATCTGTACGATTGTCCACCCTTCCTATCAATATTTTGTCACAGAAGCTAATCTTTCTACAG
GAGTTCGAAAGCGACGATCAAACATGGCCCTCTGCTGCCCGTCAATCCATTGACTCAAACGCCTTCGAGACCGAG
TTGACTTCAAACTACACCTCGTCTCAACCTCAAACACAGAGCAAGACTCGCTCATCTTCAGCAAGCTGGTCATCC
AGTCCAGAGATGAAGCAAGAAGAGATTGCTACTCCTCTACCCTCCAAACCCACCACATCCACATCCCGCAAGACC
CGTAGCTTCTCCCGAGACTCCAACCACTCCTCAACCGGCGGCCAAGACCCTCAAATGCGGAATGCAGCCAAGCGT
GCCGCCCACAACATCATTGAGAAGCGCTACCGTACCAACATGAACGCCAAATTTGTTTCTCTCGAGCAGGCCATC
TCGCCCTCGGGGGTTCAAAAACATACCAAGGTTGGCGCGGGATCTCTCAAGAAGTCCGAGATCCTCAGCAATGCC
CTCACCTACATCGATAGCATTCAGCAGGAGAACCAGGCCTTGCACAAGGAGCTCGCAATGCTCAAGCAAAACCTG
CTACCGGCGGGAGGAATCTGGCGTCAGACCAAAAACCCCCGACTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail