Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2495.t1
Gene name
Locationscaffold_03:183158..184415
Strand+
Gene length (bp)1257
Transcript length (bp)1257
Coding sequence length (bp)1257
Protein length (aa) 419

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00042 Globin Globin 1.6E-13 33 137
PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain 2.5E-11 282 392
PF00970 FAD_binding_6 Oxidoreductase FAD-binding domain 4.3E-05 158 267

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0020037 heme binding Yes
GO:0046906 tetrapyrrole binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 61.92 35.52 88.32
5d_25C Five days - 25 degrees Celsius 33.04 17.25 48.82
7d_25C Seven days - 25 degrees Celsius 57.02 30.14 83.91
10d_25C Ten days - 25 degrees Celsius 30.20 14.89 45.52
7d_15C Seven days - 15 degrees Celsius 36.77 15.93 57.62
7d_30C Seven days - 30 degrees Celsius 20.88 9.75 32.01

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.006371 yes
3d_25C 7d_25C 0.813386 no
3d_25C 7d_15C 0.054049 no
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.001804 yes
5d_25C 7d_25C 0.028409 yes
5d_25C 7d_15C 0.779065 no
5d_25C 7d_30C 0.093846 no
5d_25C 10d_25C 0.811285 no
7d_25C 7d_15C 0.122676 no
7d_25C 7d_30C 0.000700 yes
7d_25C 10d_25C 0.011688 yes
7d_15C 7d_30C 0.047513 yes
7d_15C 10d_25C 0.575212 no
7d_30C 10d_25C 0.210395 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2495.t1
MASNPGMTPDQIALIKATVPVLVEHGNTITTVFYRNMIEAHPELNTVFNSTNQANGHQPRALAGALYAYASHIDD
LGALSSAVELICNKHASLYIKPDDYKIVGKYLLEAMGEVLGAALTPEIHDAWGAAYWQLADIMIGREKQLYEHAE
GWTDWREFKIVNKVKESEEITSFYLAPVDEKPLPAFQPGQYISIQTYVPALKHLQARQYSLSDQPKPDYYRISVK
RELGLDPAAPGAAAHPGYISNLLHDTVNIGDKLNVSHPYGDFFLPPVESEAGNPIVLISAGVGLTPLTSMLNTLI
SKSPATRKLHFIHGARSSRVRAFKLHISELPNEFPSIRTTSYTSHPSEGEVEGVDYDHAGRVDLTKLKDQDLFLD
DAKTDYYICGPGKFMIDMESSLKARGVSADRIKMELFGTGGIH*
Coding >Pro_DTO377G3_2|g2495.t1
ATGGCTTCTAATCCGGGAATGACTCCAGACCAGATCGCGCTCATTAAGGCGACGGTGCCGGTTCTCGTGGAACAT
GGCAACACCATCACGACTGTCTTCTATCGCAACATGATCGAAGCCCACCCGGAGCTGAACACCGTTTTCAACAGT
ACCAACCAGGCCAATGGGCATCAACCTCGTGCGTTGGCCGGTGCACTCTACGCATATGCATCGCATATCGACGAT
CTCGGCGCACTGAGCTCGGCGGTTGAGTTGATCTGCAACAAGCATGCCTCCTTGTATATCAAGCCCGACGATTAC
AAGATTGTTGGCAAGTACCTCCTCGAAGCCATGGGCGAGGTGCTCGGCGCGGCATTGACCCCAGAAATCCACGAC
GCATGGGGTGCAGCCTACTGGCAGCTCGCAGATATCATGATTGGCCGCGAAAAGCAGCTTTACGAACACGCCGAG
GGCTGGACTGACTGGAGAGAATTCAAGATTGTGAACAAAGTCAAAGAATCCGAGGAAATCACATCCTTCTATCTC
GCCCCTGTCGATGAAAAACCACTGCCGGCCTTCCAGCCCGGCCAGTACATTTCCATCCAAACCTACGTCCCGGCT
CTCAAGCACTTGCAGGCCAGACAGTACTCTCTCAGCGACCAGCCGAAGCCGGACTACTATCGCATCAGTGTGAAA
AGAGAACTGGGCCTCGACCCAGCCGCTCCAGGTGCCGCCGCTCACCCGGGTTACATCTCAAATCTGCTACACGAT
ACAGTCAACATCGGCGACAAGCTCAATGTCTCCCATCCCTACGGTGACTTTTTCCTTCCCCCTGTCGAGTCGGAA
GCAGGCAACCCAATCGTGTTGATCTCCGCCGGTGTGGGTCTAACACCACTGACGTCGATGCTGAACACATTGATT
TCCAAATCACCCGCAACGCGCAAGCTGCATTTCATTCATGGCGCACGTTCATCACGCGTGCGTGCTTTCAAGTTG
CACATCTCCGAGCTTCCAAACGAATTCCCCTCCATTCGAACCACATCCTACACGAGTCATCCTTCCGAGGGAGAG
GTGGAGGGCGTGGACTACGACCATGCCGGGCGGGTGGACTTGACTAAGTTGAAGGATCAGGACTTGTTCCTGGAT
GATGCCAAGACGGATTACTATATCTGTGGACCCGGAAAGTTCATGATCGATATGGAGTCGAGTCTCAAGGCCAGG
GGTGTGAGTGCCGATCGCATCAAGATGGAATTGTTCGGAACGGGAGGTATTCATTGA
Transcript >Pro_DTO377G3_2|g2495.t1
ATGGCTTCTAATCCGGGAATGACTCCAGACCAGATCGCGCTCATTAAGGCGACGGTGCCGGTTCTCGTGGAACAT
GGCAACACCATCACGACTGTCTTCTATCGCAACATGATCGAAGCCCACCCGGAGCTGAACACCGTTTTCAACAGT
ACCAACCAGGCCAATGGGCATCAACCTCGTGCGTTGGCCGGTGCACTCTACGCATATGCATCGCATATCGACGAT
CTCGGCGCACTGAGCTCGGCGGTTGAGTTGATCTGCAACAAGCATGCCTCCTTGTATATCAAGCCCGACGATTAC
AAGATTGTTGGCAAGTACCTCCTCGAAGCCATGGGCGAGGTGCTCGGCGCGGCATTGACCCCAGAAATCCACGAC
GCATGGGGTGCAGCCTACTGGCAGCTCGCAGATATCATGATTGGCCGCGAAAAGCAGCTTTACGAACACGCCGAG
GGCTGGACTGACTGGAGAGAATTCAAGATTGTGAACAAAGTCAAAGAATCCGAGGAAATCACATCCTTCTATCTC
GCCCCTGTCGATGAAAAACCACTGCCGGCCTTCCAGCCCGGCCAGTACATTTCCATCCAAACCTACGTCCCGGCT
CTCAAGCACTTGCAGGCCAGACAGTACTCTCTCAGCGACCAGCCGAAGCCGGACTACTATCGCATCAGTGTGAAA
AGAGAACTGGGCCTCGACCCAGCCGCTCCAGGTGCCGCCGCTCACCCGGGTTACATCTCAAATCTGCTACACGAT
ACAGTCAACATCGGCGACAAGCTCAATGTCTCCCATCCCTACGGTGACTTTTTCCTTCCCCCTGTCGAGTCGGAA
GCAGGCAACCCAATCGTGTTGATCTCCGCCGGTGTGGGTCTAACACCACTGACGTCGATGCTGAACACATTGATT
TCCAAATCACCCGCAACGCGCAAGCTGCATTTCATTCATGGCGCACGTTCATCACGCGTGCGTGCTTTCAAGTTG
CACATCTCCGAGCTTCCAAACGAATTCCCCTCCATTCGAACCACATCCTACACGAGTCATCCTTCCGAGGGAGAG
GTGGAGGGCGTGGACTACGACCATGCCGGGCGGGTGGACTTGACTAAGTTGAAGGATCAGGACTTGTTCCTGGAT
GATGCCAAGACGGATTACTATATCTGTGGACCCGGAAAGTTCATGATCGATATGGAGTCGAGTCTCAAGGCCAGG
GGTGTGAGTGCCGATCGCATCAAGATGGAATTGTTCGGAACGGGAGGTATTCATTGA
Gene >Pro_DTO377G3_2|g2495.t1
ATGGCTTCTAATCCGGGAATGACTCCAGACCAGATCGCGCTCATTAAGGCGACGGTGCCGGTTCTCGTGGAACAT
GGCAACACCATCACGACTGTCTTCTATCGCAACATGATCGAAGCCCACCCGGAGCTGAACACCGTTTTCAACAGT
ACCAACCAGGCCAATGGGCATCAACCTCGTGCGTTGGCCGGTGCACTCTACGCATATGCATCGCATATCGACGAT
CTCGGCGCACTGAGCTCGGCGGTTGAGTTGATCTGCAACAAGCATGCCTCCTTGTATATCAAGCCCGACGATTAC
AAGATTGTTGGCAAGTACCTCCTCGAAGCCATGGGCGAGGTGCTCGGCGCGGCATTGACCCCAGAAATCCACGAC
GCATGGGGTGCAGCCTACTGGCAGCTCGCAGATATCATGATTGGCCGCGAAAAGCAGCTTTACGAACACGCCGAG
GGCTGGACTGACTGGAGAGAATTCAAGATTGTGAACAAAGTCAAAGAATCCGAGGAAATCACATCCTTCTATCTC
GCCCCTGTCGATGAAAAACCACTGCCGGCCTTCCAGCCCGGCCAGTACATTTCCATCCAAACCTACGTCCCGGCT
CTCAAGCACTTGCAGGCCAGACAGTACTCTCTCAGCGACCAGCCGAAGCCGGACTACTATCGCATCAGTGTGAAA
AGAGAACTGGGCCTCGACCCAGCCGCTCCAGGTGCCGCCGCTCACCCGGGTTACATCTCAAATCTGCTACACGAT
ACAGTCAACATCGGCGACAAGCTCAATGTCTCCCATCCCTACGGTGACTTTTTCCTTCCCCCTGTCGAGTCGGAA
GCAGGCAACCCAATCGTGTTGATCTCCGCCGGTGTGGGTCTAACACCACTGACGTCGATGCTGAACACATTGATT
TCCAAATCACCCGCAACGCGCAAGCTGCATTTCATTCATGGCGCACGTTCATCACGCGTGCGTGCTTTCAAGTTG
CACATCTCCGAGCTTCCAAACGAATTCCCCTCCATTCGAACCACATCCTACACGAGTCATCCTTCCGAGGGAGAG
GTGGAGGGCGTGGACTACGACCATGCCGGGCGGGTGGACTTGACTAAGTTGAAGGATCAGGACTTGTTCCTGGAT
GATGCCAAGACGGATTACTATATCTGTGGACCCGGAAAGTTCATGATCGATATGGAGTCGAGTCTCAAGGCCAGG
GGTGTGAGTGCCGATCGCATCAAGATGGAATTGTTCGGAACGGGAGGTATTCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail