Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2492.t1
Gene name
Locationscaffold_03:176394..177057
Strand+
Gene length (bp)663
Transcript length (bp)663
Coding sequence length (bp)663
Protein length (aa) 221

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 15.03 5.02 25.05
5d_25C Five days - 25 degrees Celsius 21.46 8.16 34.76
7d_25C Seven days - 25 degrees Celsius 20.92 7.92 33.93
10d_25C Ten days - 25 degrees Celsius 28.38 11.87 44.90
7d_15C Seven days - 15 degrees Celsius 18.29 6.38 30.21
7d_30C Seven days - 30 degrees Celsius 51.45 24.99 77.91

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.378459 no
3d_25C 7d_25C 0.415014 no
3d_25C 7d_15C 0.681356 no
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.066809 no
5d_25C 7d_25C 0.964001 no
5d_25C 7d_15C 0.729526 no
5d_25C 7d_30C 0.001804 yes
5d_25C 10d_25C 0.455884 no
7d_25C 7d_15C 0.775130 no
7d_25C 7d_30C 0.000700 yes
7d_25C 10d_25C 0.410090 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.209917 no
7d_30C 10d_25C 0.040599 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2492.t1
MKFTLISSALFLATTAMASPDGVDVNSIVSDVTGVVSTVVDGGQSVGSDVVSIATSIAEAASTGGAAAISSIKSE
ATSIAEAVSTGGAAAASSIKSEASAVATDASSIGSEITSRVATAISAQTTLTDSAGSATATESTTLTSAVSTTSS
DSSSADSSSGSSSTDSSSGSSSTESSSGSSSTASPSSSSSVSDNAAFARPTAVGAVAAGMAGVLGVMIAL*
Coding >Pro_DTO377G3_2|g2492.t1
ATGAAGTTCACTCTGATCTCCTCCGCCCTCTTCCTGGCCACCACTGCCATGGCTTCCCCAGACGGTGTTGACGTG
AACTCTATCGTCTCCGATGTCACAGGCGTCGTCTCAACTGTCGTCGACGGTGGCCAATCCGTCGGATCCGATGTC
GTCTCAATAGCCACCTCTATCGCCGAGGCCGCGAGCACCGGCGGTGCCGCTGCCATCTCATCCATCAAAAGCGAG
GCGACCTCTATCGCCGAGGCCGTGAGCACCGGCGGTGCCGCTGCCGCCTCATCCATCAAGAGTGAGGCTTCTGCC
GTCGCTACCGATGCTAGCTCCATCGGCTCTGAGATCACCAGCCGGGTTGCCACCGCCATTTCTGCTCAGACTACT
CTTACCGACTCCGCCGGCTCGGCCACCGCTACCGAGTCCACTACCCTGACCAGCGCAGTGTCCACCACATCTTCC
GACTCATCCTCCGCTGATTCTTCTTCCGGCTCCTCCTCCACTGATTCTTCTTCCGGCTCTTCGTCTACTGAGTCT
TCTTCCGGCTCTTCCTCCACCGCGTCTCCGTCTAGCTCTTCCTCTGTCTCTGACAATGCGGCCTTCGCTCGTCCC
ACTGCTGTCGGCGCTGTTGCTGCTGGTATGGCCGGTGTCCTTGGTGTCATGATTGCACTGTAA
Transcript >Pro_DTO377G3_2|g2492.t1
ATGAAGTTCACTCTGATCTCCTCCGCCCTCTTCCTGGCCACCACTGCCATGGCTTCCCCAGACGGTGTTGACGTG
AACTCTATCGTCTCCGATGTCACAGGCGTCGTCTCAACTGTCGTCGACGGTGGCCAATCCGTCGGATCCGATGTC
GTCTCAATAGCCACCTCTATCGCCGAGGCCGCGAGCACCGGCGGTGCCGCTGCCATCTCATCCATCAAAAGCGAG
GCGACCTCTATCGCCGAGGCCGTGAGCACCGGCGGTGCCGCTGCCGCCTCATCCATCAAGAGTGAGGCTTCTGCC
GTCGCTACCGATGCTAGCTCCATCGGCTCTGAGATCACCAGCCGGGTTGCCACCGCCATTTCTGCTCAGACTACT
CTTACCGACTCCGCCGGCTCGGCCACCGCTACCGAGTCCACTACCCTGACCAGCGCAGTGTCCACCACATCTTCC
GACTCATCCTCCGCTGATTCTTCTTCCGGCTCCTCCTCCACTGATTCTTCTTCCGGCTCTTCGTCTACTGAGTCT
TCTTCCGGCTCTTCCTCCACCGCGTCTCCGTCTAGCTCTTCCTCTGTCTCTGACAATGCGGCCTTCGCTCGTCCC
ACTGCTGTCGGCGCTGTTGCTGCTGGTATGGCCGGTGTCCTTGGTGTCATGATTGCACTGTAA
Gene >Pro_DTO377G3_2|g2492.t1
ATGAAGTTCACTCTGATCTCCTCCGCCCTCTTCCTGGCCACCACTGCCATGGCTTCCCCAGACGGTGTTGACGTG
AACTCTATCGTCTCCGATGTCACAGGCGTCGTCTCAACTGTCGTCGACGGTGGCCAATCCGTCGGATCCGATGTC
GTCTCAATAGCCACCTCTATCGCCGAGGCCGCGAGCACCGGCGGTGCCGCTGCCATCTCATCCATCAAAAGCGAG
GCGACCTCTATCGCCGAGGCCGTGAGCACCGGCGGTGCCGCTGCCGCCTCATCCATCAAGAGTGAGGCTTCTGCC
GTCGCTACCGATGCTAGCTCCATCGGCTCTGAGATCACCAGCCGGGTTGCCACCGCCATTTCTGCTCAGACTACT
CTTACCGACTCCGCCGGCTCGGCCACCGCTACCGAGTCCACTACCCTGACCAGCGCAGTGTCCACCACATCTTCC
GACTCATCCTCCGCTGATTCTTCTTCCGGCTCCTCCTCCACTGATTCTTCTTCCGGCTCTTCGTCTACTGAGTCT
TCTTCCGGCTCTTCCTCCACCGCGTCTCCGTCTAGCTCTTCCTCTGTCTCTGACAATGCGGCCTTCGCTCGTCCC
ACTGCTGTCGGCGCTGTTGCTGCTGGTATGGCCGGTGTCCTTGGTGTCATGATTGCACTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail