Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2490.t1
Gene name
Locationscaffold_03:167968..170464
Strand-
Gene length (bp)2496
Transcript length (bp)2496
Coding sequence length (bp)2496
Protein length (aa) 832

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06738 ThrE Putative threonine/serine exporter 1.6E-61 388 638
PF06738 ThrE Putative threonine/serine exporter 1.6E-06 669 759
PF12821 ThrE_2 Threonine/Serine exporter, ThrE 8.0E-14 668 816

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

Domain # Start End Length
1 497 516 19
2 523 545 22
3 584 606 22
4 619 641 22
5 661 680 19
6 687 704 17
7 714 731 17
8 738 760 22
9 798 820 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2490.t1
MSDASISSFNDDSDPDNTTSSEVWQDAPQTSPQEKESSPHIRFRSNAGFIQEAKHDEPPKVFREEWDLAHHEGLP
HRPTMPYSHESEDIADTPQRDREPQSSETDSESGVQRIDQNKRPGGEKKEDEKKEHETSEQQSTLEKWRTATRNF
RRKASEFGDRLGRPQAEGDDLTSGRYHADWATGGAPPLSDVTDDKHKSVEAKQRDQKGTSSEAHRLVRDLTQDHS
QKRRKGRGKPYPHPDNEFKDEENETGADASLRYRSGGGGILSQLIKLQGGQQQGAGGQSRTSTDSSSSAESAPSG
APTPKPKKQKPVKWYKKPKNTSNSTLIGGGADSFSGASTPVSSEILSQASRRRDKEGGGGGGGGNRNMRLEDEIR
VTVHIAEIICRQRYIMQLCKALMLFGAPTHRLEEYMQMTAKVLEVDSQYLYLPGCMIMSFDDPSTRTTEVKMVRV
AQGVDLARLSDTHLIYKNVIHDVIGIEEAIQELDAVIKKKPIYHKFIVILVYGLATATVGPFAFSARPIDMPIIF
LNGILVGLMQHVAAPRSVLYSNVFEVTSTVVTSFLARAFGSISLGVVNGKPQYLFCFSAIAQSSIALILPGFLVL
CSSLELQSHQIIAGSIRMVYALLFSLFIGYGITVGTTIYGLMDNHAVSDTSCPDKGAFKNPYVQRFPFVAIQTVW
LLIINQGKWKQLPPMIIIAMAGYISNYFSTKRLGSNSQVANTVGAFVIGIMGNLYSRLWHGHAATAILPGIFILV
PSGLAATGSLISGVQSADEIRQSVGSHGSSSSAPGAGLQSNSIFSLGFGMIQVAIGITIGLFISALVVYPYGKAR
SGLFSF*
Coding >Pro_DTO377G3_2|g2490.t1
ATGTCGGACGCATCCATCAGCAGCTTCAATGATGACTCGGACCCAGACAATACAACCTCGTCCGAAGTTTGGCAG
GATGCGCCCCAAACCAGTCCACAAGAGAAAGAGTCATCACCCCATATTCGATTTCGATCAAATGCGGGTTTCATA
CAGGAGGCCAAGCATGACGAACCGCCAAAAGTTTTTCGCGAAGAATGGGATTTGGCTCACCATGAAGGGCTGCCT
CATCGGCCGACAATGCCATACTCCCATGAGTCTGAGGATATTGCCGATACACCACAGCGAGATCGTGAGCCACAG
TCGAGTGAGACGGACAGCGAGTCAGGTGTCCAAAGGATAGACCAGAACAAGCGACCGGGAGGTGAGAAGAAGGAA
GACGAGAAGAAGGAACATGAGACTTCTGAACAGCAATCCACACTGGAGAAATGGCGAACTGCGACCAGGAATTTC
AGACGGAAAGCATCAGAGTTCGGTGACCGTCTGGGTCGCCCACAGGCCGAGGGAGACGACTTAACATCCGGGAGA
TATCACGCGGACTGGGCGACCGGTGGTGCACCTCCACTCTCTGATGTGACAGATGACAAGCACAAAAGTGTGGAG
GCGAAGCAGCGCGACCAGAAAGGGACTAGCTCGGAAGCCCATCGTCTAGTGCGAGATCTGACGCAAGACCATTCC
CAAAAACGCCGCAAAGGCCGTGGGAAACCTTATCCTCACCCCGACAACGAATTTAAAGACGAAGAGAATGAGACA
GGAGCAGATGCGAGCTTGAGATATCGCTCTGGCGGCGGCGGGATCCTGTCGCAGTTGATCAAACTGCAGGGTGGT
CAGCAACAAGGTGCTGGAGGCCAGTCTCGAACATCAACTGACTCATCTAGCAGCGCAGAATCGGCCCCCAGCGGG
GCCCCAACACCAAAACCTAAGAAGCAAAAGCCAGTGAAATGGTACAAAAAGCCCAAGAATACGTCGAACTCGACC
TTGATTGGTGGGGGCGCAGATAGTTTCAGTGGTGCAAGCACTCCTGTTTCAAGCGAAATCCTATCGCAAGCCTCG
AGGCGCCGTGACAAGGAGGGTGGCGGTGGCGGCGGTGGTGGAAATCGCAATATGCGGCTTGAGGATGAGATTCGA
GTGACAGTGCACATTGCAGAAATTATCTGTCGGCAGCGGTATATCATGCAGCTCTGCAAAGCATTGATGTTATTT
GGTGCTCCCACACACAGGCTTGAAGAGTACATGCAGATGACCGCAAAGGTATTGGAGGTTGATAGCCAATACCTG
TATCTGCCAGGCTGCATGATAATGTCGTTCGACGATCCATCTACCCGCACGACAGAGGTGAAGATGGTTCGAGTA
GCCCAGGGAGTTGATTTAGCTCGCCTATCGGACACACATCTCATCTACAAGAATGTGATCCACGATGTGATCGGC
ATTGAAGAAGCAATTCAGGAACTCGATGCGGTCATCAAGAAAAAGCCCATATATCACAAGTTCATCGTCATCTTG
GTGTACGGGTTGGCCACTGCAACAGTCGGGCCTTTCGCTTTTAGTGCCAGGCCGATTGACATGCCGATCATTTTT
CTCAATGGTATACTTGTCGGTTTAATGCAACACGTCGCCGCGCCTCGTTCCGTGTTGTATTCAAATGTCTTTGAA
GTGACATCGACAGTGGTGACGTCCTTCCTCGCCCGCGCTTTCGGTAGTATCTCCCTTGGAGTCGTGAATGGCAAG
CCACAATACCTCTTTTGCTTTTCCGCCATCGCGCAATCATCGATTGCATTGATATTGCCAGGATTCCTTGTTCTT
TGTAGTAGCTTGGAACTTCAATCCCATCAGATCATCGCTGGCTCGATTCGGATGGTCTATGCTCTCCTCTTCTCG
TTGTTTATTGGATATGGAATTACCGTTGGCACAACCATCTACGGTCTGATGGACAACCACGCGGTCTCCGACACC
TCCTGCCCAGACAAGGGAGCCTTTAAGAATCCATATGTTCAACGTTTCCCTTTCGTTGCAATCCAGACAGTCTGG
CTTTTGATCATCAACCAAGGAAAATGGAAACAGCTTCCACCTATGATCATCATCGCAATGGCGGGCTACATTAGC
AACTACTTCAGCACGAAGAGACTGGGATCAAACTCCCAGGTAGCGAATACAGTCGGCGCGTTTGTCATCGGCATC
ATGGGAAATCTGTACAGTCGGCTCTGGCATGGCCATGCCGCGACCGCTATTCTGCCTGGAATTTTCATTCTGGTT
CCATCTGGACTTGCTGCGACGGGATCTCTGATCTCGGGTGTACAGTCCGCGGATGAAATTCGTCAAAGCGTCGGG
TCTCATGGTAGCAGTAGTTCAGCGCCCGGCGCTGGCTTGCAATCCAATTCTATATTCAGTCTAGGGTTTGGCATG
ATCCAGGTGGCTATTGGCATTACGATTGGTTTGTTCATTTCCGCACTGGTGGTTTATCCATACGGCAAGGCCCGG
AGCGGACTATTTAGTTTCTAG
Transcript >Pro_DTO377G3_2|g2490.t1
ATGTCGGACGCATCCATCAGCAGCTTCAATGATGACTCGGACCCAGACAATACAACCTCGTCCGAAGTTTGGCAG
GATGCGCCCCAAACCAGTCCACAAGAGAAAGAGTCATCACCCCATATTCGATTTCGATCAAATGCGGGTTTCATA
CAGGAGGCCAAGCATGACGAACCGCCAAAAGTTTTTCGCGAAGAATGGGATTTGGCTCACCATGAAGGGCTGCCT
CATCGGCCGACAATGCCATACTCCCATGAGTCTGAGGATATTGCCGATACACCACAGCGAGATCGTGAGCCACAG
TCGAGTGAGACGGACAGCGAGTCAGGTGTCCAAAGGATAGACCAGAACAAGCGACCGGGAGGTGAGAAGAAGGAA
GACGAGAAGAAGGAACATGAGACTTCTGAACAGCAATCCACACTGGAGAAATGGCGAACTGCGACCAGGAATTTC
AGACGGAAAGCATCAGAGTTCGGTGACCGTCTGGGTCGCCCACAGGCCGAGGGAGACGACTTAACATCCGGGAGA
TATCACGCGGACTGGGCGACCGGTGGTGCACCTCCACTCTCTGATGTGACAGATGACAAGCACAAAAGTGTGGAG
GCGAAGCAGCGCGACCAGAAAGGGACTAGCTCGGAAGCCCATCGTCTAGTGCGAGATCTGACGCAAGACCATTCC
CAAAAACGCCGCAAAGGCCGTGGGAAACCTTATCCTCACCCCGACAACGAATTTAAAGACGAAGAGAATGAGACA
GGAGCAGATGCGAGCTTGAGATATCGCTCTGGCGGCGGCGGGATCCTGTCGCAGTTGATCAAACTGCAGGGTGGT
CAGCAACAAGGTGCTGGAGGCCAGTCTCGAACATCAACTGACTCATCTAGCAGCGCAGAATCGGCCCCCAGCGGG
GCCCCAACACCAAAACCTAAGAAGCAAAAGCCAGTGAAATGGTACAAAAAGCCCAAGAATACGTCGAACTCGACC
TTGATTGGTGGGGGCGCAGATAGTTTCAGTGGTGCAAGCACTCCTGTTTCAAGCGAAATCCTATCGCAAGCCTCG
AGGCGCCGTGACAAGGAGGGTGGCGGTGGCGGCGGTGGTGGAAATCGCAATATGCGGCTTGAGGATGAGATTCGA
GTGACAGTGCACATTGCAGAAATTATCTGTCGGCAGCGGTATATCATGCAGCTCTGCAAAGCATTGATGTTATTT
GGTGCTCCCACACACAGGCTTGAAGAGTACATGCAGATGACCGCAAAGGTATTGGAGGTTGATAGCCAATACCTG
TATCTGCCAGGCTGCATGATAATGTCGTTCGACGATCCATCTACCCGCACGACAGAGGTGAAGATGGTTCGAGTA
GCCCAGGGAGTTGATTTAGCTCGCCTATCGGACACACATCTCATCTACAAGAATGTGATCCACGATGTGATCGGC
ATTGAAGAAGCAATTCAGGAACTCGATGCGGTCATCAAGAAAAAGCCCATATATCACAAGTTCATCGTCATCTTG
GTGTACGGGTTGGCCACTGCAACAGTCGGGCCTTTCGCTTTTAGTGCCAGGCCGATTGACATGCCGATCATTTTT
CTCAATGGTATACTTGTCGGTTTAATGCAACACGTCGCCGCGCCTCGTTCCGTGTTGTATTCAAATGTCTTTGAA
GTGACATCGACAGTGGTGACGTCCTTCCTCGCCCGCGCTTTCGGTAGTATCTCCCTTGGAGTCGTGAATGGCAAG
CCACAATACCTCTTTTGCTTTTCCGCCATCGCGCAATCATCGATTGCATTGATATTGCCAGGATTCCTTGTTCTT
TGTAGTAGCTTGGAACTTCAATCCCATCAGATCATCGCTGGCTCGATTCGGATGGTCTATGCTCTCCTCTTCTCG
TTGTTTATTGGATATGGAATTACCGTTGGCACAACCATCTACGGTCTGATGGACAACCACGCGGTCTCCGACACC
TCCTGCCCAGACAAGGGAGCCTTTAAGAATCCATATGTTCAACGTTTCCCTTTCGTTGCAATCCAGACAGTCTGG
CTTTTGATCATCAACCAAGGAAAATGGAAACAGCTTCCACCTATGATCATCATCGCAATGGCGGGCTACATTAGC
AACTACTTCAGCACGAAGAGACTGGGATCAAACTCCCAGGTAGCGAATACAGTCGGCGCGTTTGTCATCGGCATC
ATGGGAAATCTGTACAGTCGGCTCTGGCATGGCCATGCCGCGACCGCTATTCTGCCTGGAATTTTCATTCTGGTT
CCATCTGGACTTGCTGCGACGGGATCTCTGATCTCGGGTGTACAGTCCGCGGATGAAATTCGTCAAAGCGTCGGG
TCTCATGGTAGCAGTAGTTCAGCGCCCGGCGCTGGCTTGCAATCCAATTCTATATTCAGTCTAGGGTTTGGCATG
ATCCAGGTGGCTATTGGCATTACGATTGGTTTGTTCATTTCCGCACTGGTGGTTTATCCATACGGCAAGGCCCGG
AGCGGACTATTTAGTTTCTAG
Gene >Pro_DTO377G3_2|g2490.t1
ATGTCGGACGCATCCATCAGCAGCTTCAATGATGACTCGGACCCAGACAATACAACCTCGTCCGAAGTTTGGCAG
GATGCGCCCCAAACCAGTCCACAAGAGAAAGAGTCATCACCCCATATTCGATTTCGATCAAATGCGGGTTTCATA
CAGGAGGCCAAGCATGACGAACCGCCAAAAGTTTTTCGCGAAGAATGGGATTTGGCTCACCATGAAGGGCTGCCT
CATCGGCCGACAATGCCATACTCCCATGAGTCTGAGGATATTGCCGATACACCACAGCGAGATCGTGAGCCACAG
TCGAGTGAGACGGACAGCGAGTCAGGTGTCCAAAGGATAGACCAGAACAAGCGACCGGGAGGTGAGAAGAAGGAA
GACGAGAAGAAGGAACATGAGACTTCTGAACAGCAATCCACACTGGAGAAATGGCGAACTGCGACCAGGAATTTC
AGACGGAAAGCATCAGAGTTCGGTGACCGTCTGGGTCGCCCACAGGCCGAGGGAGACGACTTAACATCCGGGAGA
TATCACGCGGACTGGGCGACCGGTGGTGCACCTCCACTCTCTGATGTGACAGATGACAAGCACAAAAGTGTGGAG
GCGAAGCAGCGCGACCAGAAAGGGACTAGCTCGGAAGCCCATCGTCTAGTGCGAGATCTGACGCAAGACCATTCC
CAAAAACGCCGCAAAGGCCGTGGGAAACCTTATCCTCACCCCGACAACGAATTTAAAGACGAAGAGAATGAGACA
GGAGCAGATGCGAGCTTGAGATATCGCTCTGGCGGCGGCGGGATCCTGTCGCAGTTGATCAAACTGCAGGGTGGT
CAGCAACAAGGTGCTGGAGGCCAGTCTCGAACATCAACTGACTCATCTAGCAGCGCAGAATCGGCCCCCAGCGGG
GCCCCAACACCAAAACCTAAGAAGCAAAAGCCAGTGAAATGGTACAAAAAGCCCAAGAATACGTCGAACTCGACC
TTGATTGGTGGGGGCGCAGATAGTTTCAGTGGTGCAAGCACTCCTGTTTCAAGCGAAATCCTATCGCAAGCCTCG
AGGCGCCGTGACAAGGAGGGTGGCGGTGGCGGCGGTGGTGGAAATCGCAATATGCGGCTTGAGGATGAGATTCGA
GTGACAGTGCACATTGCAGAAATTATCTGTCGGCAGCGGTATATCATGCAGCTCTGCAAAGCATTGATGTTATTT
GGTGCTCCCACACACAGGCTTGAAGAGTACATGCAGATGACCGCAAAGGTATTGGAGGTTGATAGCCAATACCTG
TATCTGCCAGGCTGCATGATAATGTCGTTCGACGATCCATCTACCCGCACGACAGAGGTGAAGATGGTTCGAGTA
GCCCAGGGAGTTGATTTAGCTCGCCTATCGGACACACATCTCATCTACAAGAATGTGATCCACGATGTGATCGGC
ATTGAAGAAGCAATTCAGGAACTCGATGCGGTCATCAAGAAAAAGCCCATATATCACAAGTTCATCGTCATCTTG
GTGTACGGGTTGGCCACTGCAACAGTCGGGCCTTTCGCTTTTAGTGCCAGGCCGATTGACATGCCGATCATTTTT
CTCAATGGTATACTTGTCGGTTTAATGCAACACGTCGCCGCGCCTCGTTCCGTGTTGTATTCAAATGTCTTTGAA
GTGACATCGACAGTGGTGACGTCCTTCCTCGCCCGCGCTTTCGGTAGTATCTCCCTTGGAGTCGTGAATGGCAAG
CCACAATACCTCTTTTGCTTTTCCGCCATCGCGCAATCATCGATTGCATTGATATTGCCAGGATTCCTTGTTCTT
TGTAGTAGCTTGGAACTTCAATCCCATCAGATCATCGCTGGCTCGATTCGGATGGTCTATGCTCTCCTCTTCTCG
TTGTTTATTGGATATGGAATTACCGTTGGCACAACCATCTACGGTCTGATGGACAACCACGCGGTCTCCGACACC
TCCTGCCCAGACAAGGGAGCCTTTAAGAATCCATATGTTCAACGTTTCCCTTTCGTTGCAATCCAGACAGTCTGG
CTTTTGATCATCAACCAAGGAAAATGGAAACAGCTTCCACCTATGATCATCATCGCAATGGCGGGCTACATTAGC
AACTACTTCAGCACGAAGAGACTGGGATCAAACTCCCAGGTAGCGAATACAGTCGGCGCGTTTGTCATCGGCATC
ATGGGAAATCTGTACAGTCGGCTCTGGCATGGCCATGCCGCGACCGCTATTCTGCCTGGAATTTTCATTCTGGTT
CCATCTGGACTTGCTGCGACGGGATCTCTGATCTCGGGTGTACAGTCCGCGGATGAAATTCGTCAAAGCGTCGGG
TCTCATGGTAGCAGTAGTTCAGCGCCCGGCGCTGGCTTGCAATCCAATTCTATATTCAGTCTAGGGTTTGGCATG
ATCCAGGTGGCTATTGGCATTACGATTGGTTTGTTCATTTCCGCACTGGTGGTTTATCCATACGGCAAGGCCCGG
AGCGGACTATTTAGTTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail