Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2472.t1
Gene name
Locationscaffold_03:124593..126209
Strand+
Gene length (bp)1616
Transcript length (bp)1500
Coding sequence length (bp)1500
Protein length (aa) 500

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01070 FMN_dh FMN-dependent dehydrogenase 6.8E-122 121 463
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 2.2E-22 11 79
PF01645 Glu_synthase Conserved region in glutamate synthase 2.0E-06 371 424

GO

GO Term Description Terminal node
GO:0006537 glutamate biosynthetic process Yes
GO:0055114 oxidation-reduction process Yes
GO:0016638 oxidoreductase activity, acting on the CH-NH2 group of donors Yes
GO:0015930 glutamate synthase activity Yes
GO:0016491 oxidoreductase activity Yes
GO:1901566 organonitrogen compound biosynthetic process No
GO:0043436 oxoacid metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0043650 dicarboxylic acid biosynthetic process No
GO:1901605 alpha-amino acid metabolic process No
GO:0003824 catalytic activity No
GO:0046394 carboxylic acid biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0043648 dicarboxylic acid metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0009084 glutamine family amino acid biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008652 cellular amino acid biosynthetic process No
GO:0044237 cellular metabolic process No
GO:1901607 alpha-amino acid biosynthetic process No
GO:0009064 glutamine family amino acid metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0006520 cellular amino acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0008152 metabolic process No
GO:0044281 small molecule metabolic process No
GO:0008150 biological_process No
GO:1901576 organic substance biosynthetic process No
GO:0006536 glutamate metabolic process No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0009058 biosynthetic process No
GO:0016053 organic acid biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2472.t1
MSAGKLTGAVVAEHNSKDSCWIIVHGKAYDVTEFLPEHPGGQKIILKYAGKDATEEFEPIHPPDTLDKFLDPSKH
LGAVDMATVEQEEKAFDPEEAERQERISRMPHLEACYNLLDFEVVARQVMKKTAWAYYSSGADDEITMRENHAAF
HKIWFRPRILVDVEHIDMTTTMLGTKCSIPFYVTATALGKLGHPEGEVVLTKAAHEHNVVQMIPTLASCSLDEII
DAKQGDQVQWLQLYVNKDREITRKIVEHAEERGCKGLFITVDAPQLGRREKDMRSKFSDPGSNVQSGGDDIDRTQ
GAARAISSFIDPGLSWKDIPWFKSITRMPIVLKGVQCVEDVLRAVEAGCDGVVLSNHGGRQLETARSGIEVLAEV
MPALRERGWENRIEVYVDGGVRRATDILKALCLGARGIGIGRPFLYAMSAYGLDGVNRAMQLLKDEMEMNMRLIG
APTVADLSPSLLDTRGLLGGHSGVVPSDTLGLSAYDPLQVPRFNEKPKL*
Coding >Pro_DTO377G3_2|g2472.t1
ATGAGCGCAGGCAAGCTCACCGGCGCCGTTGTCGCCGAGCACAACTCCAAAGACTCGTGCTGGATCATTGTGCAC
GGCAAAGCCTACGACGTAACCGAATTCCTCCCGGAACACCCTGGTGGCCAGAAGATCATCCTCAAGTATGCAGGC
AAAGATGCGACCGAAGAGTTCGAACCAATCCACCCACCCGATACCCTGGACAAGTTCCTGGACCCGTCGAAGCAC
TTGGGAGCAGTAGACATGGCAACCGTTGAGCAGGAAGAAAAAGCCTTCGACCCGGAGGAAGCCGAACGCCAAGAG
CGCATTTCCCGCATGCCCCATCTCGAGGCTTGCTACAACCTGCTGGACTTTGAGGTGGTGGCCCGCCAAGTTATG
AAGAAGACGGCGTGGGCATACTACTCTAGCGGAGCAGATGATGAAATTACAATGCGCGAGAACCATGCAGCCTTC
CACAAAATCTGGTTCAGGCCGCGAATTCTAGTCGATGTCGAGCACATCGACATGACCACAACAATGCTGGGCACA
AAATGCTCAATCCCATTCTACGTGACTGCCACGGCGCTCGGCAAGCTGGGCCACCCAGAAGGCGAAGTGGTGCTC
ACAAAAGCCGCCCACGAACACAACGTAGTACAAATGATTCCCACGCTAGCCTCATGCTCCTTGGACGAAATCATT
GACGCCAAACAAGGCGACCAAGTGCAATGGCTCCAGCTATACGTCAACAAAGACCGCGAAATCACGCGCAAGATT
GTCGAGCATGCCGAGGAGCGCGGCTGCAAGGGCCTCTTCATCACCGTCGACGCGCCCCAACTCGGCCGCCGCGAG
AAAGATATGCGTTCTAAATTCTCCGATCCTGGCTCGAACGTCCAGTCCGGCGGCGATGACATCGACCGCACCCAG
GGCGCCGCCCGCGCCATCTCCTCCTTCATCGACCCCGGGCTCTCCTGGAAGGATATCCCCTGGTTCAAATCCATC
ACACGCATGCCGATCGTGCTGAAGGGCGTGCAGTGTGTTGAGGACGTCCTGCGCGCCGTCGAGGCAGGCTGCGAC
GGCGTCGTGCTCTCCAACCACGGCGGCCGACAGCTCGAGACCGCGCGGTCCGGCATCGAGGTTTTGGCCGAGGTG
ATGCCTGCGCTCCGCGAGCGTGGCTGGGAAAATCGCATTGAAGTCTATGTTGACGGCGGTGTGCGTCGCGCAACT
GATATCCTTAAAGCGCTTTGTCTAGGCGCGAGGGGTATTGGTATTGGGCGGCCGTTCCTGTATGCCATGTCTGCT
TATGGGCTTGATGGTGTGAACCGTGCTATGCAGCTGCTGAAGGATGAGATGGAGATGAACATGCGGTTGATTGGA
GCTCCGACTGTGGCGGATCTCAGTCCTAGTCTGCTTGATACTCGCGGGTTGTTGGGTGGGCACTCCGGGGTTGTG
CCGTCTGATACCCTTGGCCTTAGTGCATATGATCCATTGCAGGTGCCGAGGTTTAATGAGAAGCCGAAGCTGTAA
Transcript >Pro_DTO377G3_2|g2472.t1
ATGAGCGCAGGCAAGCTCACCGGCGCCGTTGTCGCCGAGCACAACTCCAAAGACTCGTGCTGGATCATTGTGCAC
GGCAAAGCCTACGACGTAACCGAATTCCTCCCGGAACACCCTGGTGGCCAGAAGATCATCCTCAAGTATGCAGGC
AAAGATGCGACCGAAGAGTTCGAACCAATCCACCCACCCGATACCCTGGACAAGTTCCTGGACCCGTCGAAGCAC
TTGGGAGCAGTAGACATGGCAACCGTTGAGCAGGAAGAAAAAGCCTTCGACCCGGAGGAAGCCGAACGCCAAGAG
CGCATTTCCCGCATGCCCCATCTCGAGGCTTGCTACAACCTGCTGGACTTTGAGGTGGTGGCCCGCCAAGTTATG
AAGAAGACGGCGTGGGCATACTACTCTAGCGGAGCAGATGATGAAATTACAATGCGCGAGAACCATGCAGCCTTC
CACAAAATCTGGTTCAGGCCGCGAATTCTAGTCGATGTCGAGCACATCGACATGACCACAACAATGCTGGGCACA
AAATGCTCAATCCCATTCTACGTGACTGCCACGGCGCTCGGCAAGCTGGGCCACCCAGAAGGCGAAGTGGTGCTC
ACAAAAGCCGCCCACGAACACAACGTAGTACAAATGATTCCCACGCTAGCCTCATGCTCCTTGGACGAAATCATT
GACGCCAAACAAGGCGACCAAGTGCAATGGCTCCAGCTATACGTCAACAAAGACCGCGAAATCACGCGCAAGATT
GTCGAGCATGCCGAGGAGCGCGGCTGCAAGGGCCTCTTCATCACCGTCGACGCGCCCCAACTCGGCCGCCGCGAG
AAAGATATGCGTTCTAAATTCTCCGATCCTGGCTCGAACGTCCAGTCCGGCGGCGATGACATCGACCGCACCCAG
GGCGCCGCCCGCGCCATCTCCTCCTTCATCGACCCCGGGCTCTCCTGGAAGGATATCCCCTGGTTCAAATCCATC
ACACGCATGCCGATCGTGCTGAAGGGCGTGCAGTGTGTTGAGGACGTCCTGCGCGCCGTCGAGGCAGGCTGCGAC
GGCGTCGTGCTCTCCAACCACGGCGGCCGACAGCTCGAGACCGCGCGGTCCGGCATCGAGGTTTTGGCCGAGGTG
ATGCCTGCGCTCCGCGAGCGTGGCTGGGAAAATCGCATTGAAGTCTATGTTGACGGCGGTGTGCGTCGCGCAACT
GATATCCTTAAAGCGCTTTGTCTAGGCGCGAGGGGTATTGGTATTGGGCGGCCGTTCCTGTATGCCATGTCTGCT
TATGGGCTTGATGGTGTGAACCGTGCTATGCAGCTGCTGAAGGATGAGATGGAGATGAACATGCGGTTGATTGGA
GCTCCGACTGTGGCGGATCTCAGTCCTAGTCTGCTTGATACTCGCGGGTTGTTGGGTGGGCACTCCGGGGTTGTG
CCGTCTGATACCCTTGGCCTTAGTGCATATGATCCATTGCAGGTGCCGAGGTTTAATGAGAAGCCGAAGCTGTAA
Gene >Pro_DTO377G3_2|g2472.t1
ATGAGCGCAGGCAAGCTCACCGGCGCCGTTGTCGCCGAGCACAACTCCAAAGACTCGTGCTGGATCATTGTGCAC
GGCAAAGCCTACGACGTAACCGAATTCCTCCCGGGTGTGTGTTTCTTTACTACGTTTCCCTCCTCGAATGTGTAC
TAATATTTCTCAGAACACCCTGGTGGCCAGAAGATCATCCTCAAGTATGCAGGCAAAGATGCGACCGAAGAGTTC
GAACCAATCCACCCACCCGATACCCTGGACAAGTTCCTGGACCCGTCGAAGCACTTGGGAGCAGTAGACATGGCA
ACCGTTGAGCAGGAAGAAAAAGCCTTCGACCCGGAGGAAGCCGAACGCCAAGAGCGCATTTCCCGCATGCCCCAT
CTCGAGGCTTGCTACAACCTGCTGGACTTTGAGGTGGTGGCCCGCCAAGTTATGAAGAAGACGGCGTGGGCATAC
TACTCTAGCGGAGCAGATGATGAAATTGTAAGCTACCATGATGATTTATACCCCCAGGCACGAAATCCCCAGTGC
TAACCTATAACCAGACAATGCGCGAGAACCATGCAGCCTTCCACAAAATCTGGTTCAGGCCGCGAATTCTAGTCG
ATGTCGAGCACATCGACATGACCACAACAATGCTGGGCACAAAATGCTCAATCCCATTCTACGTGACTGCCACGG
CGCTCGGCAAGCTGGGCCACCCAGAAGGCGAAGTGGTGCTCACAAAAGCCGCCCACGAACACAACGTAGTACAAA
TGATTCCCACGCTAGCCTCATGCTCCTTGGACGAAATCATTGACGCCAAACAAGGCGACCAAGTGCAATGGCTCC
AGCTATACGTCAACAAAGACCGCGAAATCACGCGCAAGATTGTCGAGCATGCCGAGGAGCGCGGCTGCAAGGGCC
TCTTCATCACCGTCGACGCGCCCCAACTCGGCCGCCGCGAGAAAGATATGCGTTCTAAATTCTCCGATCCTGGCT
CGAACGTCCAGTCCGGCGGCGATGACATCGACCGCACCCAGGGCGCCGCCCGCGCCATCTCCTCCTTCATCGACC
CCGGGCTCTCCTGGAAGGATATCCCCTGGTTCAAATCCATCACACGCATGCCGATCGTGCTGAAGGGCGTGCAGT
GTGTTGAGGACGTCCTGCGCGCCGTCGAGGCAGGCTGCGACGGCGTCGTGCTCTCCAACCACGGCGGCCGACAGC
TCGAGACCGCGCGGTCCGGCATCGAGGTTTTGGCCGAGGTGATGCCTGCGCTCCGCGAGCGTGGCTGGGAAAATC
GCATTGAAGTCTATGTTGACGGCGGTGTGCGTCGCGCAACTGATATCCTTAAAGCGCTTTGTCTAGGCGCGAGGG
GTATTGGTATTGGGCGGCCGTTCCTGTATGCCATGTCTGCTTATGGGCTTGATGGTGTGAACCGTGCTATGCAGC
TGCTGAAGGATGAGATGGAGATGAACATGCGGTTGATTGGAGCTCCGACTGTGGCGGATCTCAGTCCTAGTCTGC
TTGATACTCGCGGGTTGTTGGGTGGGCACTCCGGGGTTGTGCCGTCTGATACCCTTGGCCTTAGTGCATATGATC
CATTGCAGGTGCCGAGGTTTAATGAGAAGCCGAAGCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail