Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2468.t1
Gene name
Locationscaffold_03:113577..114631
Strand-
Gene length (bp)1054
Transcript length (bp)942
Coding sequence length (bp)942
Protein length (aa) 314

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11913 DUF3431 Protein of unknown function (DUF3431) 5.8E-84 85 303

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 55.35 31.13 79.57
5d_25C Five days - 25 degrees Celsius 66.03 38.21 93.85
7d_25C Seven days - 25 degrees Celsius 66.89 38.65 95.13
10d_25C Ten days - 25 degrees Celsius 89.34 53.40 125.27
7d_15C Seven days - 15 degrees Celsius 47.29 25.85 68.74
7d_30C Seven days - 30 degrees Celsius 71.17 41.50 100.85

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.531321 no
3d_25C 7d_25C 0.498593 no
3d_25C 7d_15C 0.605349 no
3d_25C 7d_30C 0.335611 no
3d_25C 10d_25C 0.034125 yes
5d_25C 7d_25C 0.971859 no
5d_25C 7d_15C 0.172670 no
5d_25C 7d_30C 0.818989 no
5d_25C 10d_25C 0.202164 no
7d_25C 7d_15C 0.152787 no
7d_25C 7d_30C 0.855367 no
7d_25C 10d_25C 0.226648 no
7d_15C 7d_30C 0.084423 no
7d_15C 10d_25C 0.004045 yes
7d_30C 10d_25C 0.380252 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2468.t1
MRLSLRVSAAAALIILTLVLVCRNLKTKGESLQDIWHFDTGSFRTSLRPKPQPDPSQRKWRVASDRKPALVYQTT
DIVVPNQGAIVMAKLKEEDTAWVGAELAEWRSVIYTVDDINAPTHTPKNKGREALPYLKYLVDHYDDLPDIVVFL
HSHRDGLLAGWHIDTMDYSNVDSVRALQKEFVQQAGYVNLRCQLSPGCPSAIQPFRQPPNPESKGEAHYAAAWKE
LFPGEPVPKEVAGPCCSQFAVSREQILQRPHSDYQRMYDWVMNNELPDDVTAAIMEYSWHIIFGKDPVFCPDLFQ
CYADVYGEEVIFT*
Coding >Pro_DTO377G3_2|g2468.t1
ATGAGGTTGTCACTTCGTGTTAGTGCCGCTGCCGCACTAATTATCCTGACTCTCGTCCTGGTCTGTCGCAATCTG
AAGACCAAAGGCGAATCACTCCAGGATATATGGCACTTCGATACCGGCTCCTTCCGTACATCCCTCAGACCAAAA
CCCCAGCCTGATCCATCACAACGGAAATGGCGGGTTGCATCGGACAGAAAACCCGCGTTGGTCTACCAGACCACC
GATATCGTGGTCCCCAACCAGGGTGCTATTGTGATGGCCAAGCTTAAGGAGGAAGACACCGCTTGGGTCGGGGCA
GAACTAGCAGAATGGCGCAGCGTCATTTACACCGTCGACGATATCAATGCCCCGACGCACACCCCGAAAAACAAG
GGTCGCGAGGCTCTCCCCTACCTCAAATATCTGGTCGACCACTACGACGACCTTCCAGACATCGTGGTCTTCCTG
CATAGCCACCGCGACGGCCTACTCGCCGGCTGGCACATCGACACCATGGATTACAGCAATGTGGACTCGGTGCGG
GCATTGCAGAAAGAATTCGTGCAACAGGCAGGCTATGTCAATCTCCGTTGCCAATTGAGCCCAGGATGCCCCTCG
GCCATCCAACCATTCCGTCAACCCCCGAATCCCGAAAGCAAAGGCGAGGCACACTACGCTGCTGCGTGGAAAGAG
CTGTTCCCTGGGGAACCGGTTCCCAAGGAAGTCGCCGGCCCATGCTGCTCTCAGTTTGCGGTTTCCCGAGAGCAG
ATTCTCCAGCGCCCTCATAGCGATTACCAGCGCATGTATGACTGGGTGATGAACAACGAACTGCCGGACGACGTT
ACCGCGGCAATTATGGAGTACTCATGGCACATCATTTTCGGCAAAGATCCTGTCTTCTGTCCCGATTTGTTCCAA
TGCTACGCAGATGTCTACGGCGAAGAAGTCATCTTTACCTAA
Transcript >Pro_DTO377G3_2|g2468.t1
ATGAGGTTGTCACTTCGTGTTAGTGCCGCTGCCGCACTAATTATCCTGACTCTCGTCCTGGTCTGTCGCAATCTG
AAGACCAAAGGCGAATCACTCCAGGATATATGGCACTTCGATACCGGCTCCTTCCGTACATCCCTCAGACCAAAA
CCCCAGCCTGATCCATCACAACGGAAATGGCGGGTTGCATCGGACAGAAAACCCGCGTTGGTCTACCAGACCACC
GATATCGTGGTCCCCAACCAGGGTGCTATTGTGATGGCCAAGCTTAAGGAGGAAGACACCGCTTGGGTCGGGGCA
GAACTAGCAGAATGGCGCAGCGTCATTTACACCGTCGACGATATCAATGCCCCGACGCACACCCCGAAAAACAAG
GGTCGCGAGGCTCTCCCCTACCTCAAATATCTGGTCGACCACTACGACGACCTTCCAGACATCGTGGTCTTCCTG
CATAGCCACCGCGACGGCCTACTCGCCGGCTGGCACATCGACACCATGGATTACAGCAATGTGGACTCGGTGCGG
GCATTGCAGAAAGAATTCGTGCAACAGGCAGGCTATGTCAATCTCCGTTGCCAATTGAGCCCAGGATGCCCCTCG
GCCATCCAACCATTCCGTCAACCCCCGAATCCCGAAAGCAAAGGCGAGGCACACTACGCTGCTGCGTGGAAAGAG
CTGTTCCCTGGGGAACCGGTTCCCAAGGAAGTCGCCGGCCCATGCTGCTCTCAGTTTGCGGTTTCCCGAGAGCAG
ATTCTCCAGCGCCCTCATAGCGATTACCAGCGCATGTATGACTGGGTGATGAACAACGAACTGCCGGACGACGTT
ACCGCGGCAATTATGGAGTACTCATGGCACATCATTTTCGGCAAAGATCCTGTCTTCTGTCCCGATTTGTTCCAA
TGCTACGCAGATGTCTACGGCGAAGAAGTCATCTTTACCTAA
Gene >Pro_DTO377G3_2|g2468.t1
ATGAGGTTGTCACTTCGTGTTAGTGCCGCTGCCGCACTAATTATCCTGACTCTCGTCCTGGTCTGTCGCAATCTG
AAGACCAAAGGCGAATCACTCCAGGATATATGGCACTTCGATACCGGCTCCTTCCGTACATCCCTCAGACCAAAA
CCCCAGCCTGATCCATCACAACGGAAATGGCGGGTTGCATCGGACAGAAAACCCGCGTTGGTCTACCAGACCACC
GATATCGTGGTCCCCAACCAGGGTGCTATTGTGATGGCCAAGCTTAAGGAGGAAGACACCGCTTGGGTCGGGGCA
GAACTAGCAGAGTGAGTGTGACTCGATTGTATTCCCAGAACAAGACCCTAACTGAATATCTCCAGATGGCGCAGC
GTCATTTACACCGTCGACGATATCAATGCCCCGACGCACACCCCGAAAAACAAGGGTCGCGAGGCTCTCCCCTAC
CTCAAATATCTGGTCGACCACTACGACGACCTTCCAGACATCGTGGTCTTCCTGCATAGCCACCGCGACGGCCTA
CTCGCCGGCTGGCACATCGACACCATGGATTACAGCAATGTGGACTCGGTGCGGGCATTGCAGAAAGAATTCGTG
CAACAGGCAGGCTATGTCAATCTCCGTTGCCAATTGAGCCCAGGATGCCCCTCGGCCATCCAACCATTCCGTCAA
CCCCCGAATCCCGAAAGCAAAGGCGAGGCACACTACGCTGCTGCGTGGAAAGAGCTGTTCCCTGGGGAACCGGTT
CCCAAGGAAGTCGCCGGCCCATGCTGCTCTCAGTTTGCGGTTTCCCGAGAGCAGATTCTCCAGCGCCCTCATAGC
GATTACCAGCGCATGTATGACTGGGTGATGAACAACGAACTGCCGGACGACGTTACCGCGGCAATTATGGAGTAC
TCATGGCACATCATTTTCGGCAAAGATCCTGTCTTGTAAGTTATCCTGCAATTGTATTATTTGTATTTTCCCCGC
TAACACGTTTAATTGCAGCTGTCCCGATTTGTTCCAATGCTACGCAGATGTCTACGGCGAAGAAGTCATCTTTAC
CTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail