Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2465.t1
Gene name
Locationscaffold_03:109066..110512
Strand+
Gene length (bp)1446
Transcript length (bp)1446
Coding sequence length (bp)1446
Protein length (aa) 482

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00296 Bac_luciferase Luciferase-like monooxygenase 1.3E-55 43 400

GO

GO Term Description Terminal node
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0016491 oxidoreductase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 16.13 7.87 24.38
5d_25C Five days - 25 degrees Celsius 12.00 5.38 18.62
7d_25C Seven days - 25 degrees Celsius 10.45 4.40 16.49
10d_25C Ten days - 25 degrees Celsius 11.12 4.83 17.42
7d_15C Seven days - 15 degrees Celsius 11.65 4.58 18.72
7d_30C Seven days - 30 degrees Celsius 12.80 5.80 19.79

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.371751 no
3d_25C 7d_25C 0.166130 no
3d_25C 7d_15C 0.359785 no
3d_25C 7d_30C 0.512545 no
3d_25C 10d_25C 0.234604 no
5d_25C 7d_25C 0.739551 no
5d_25C 7d_15C 0.955992 no
5d_25C 7d_30C 0.891505 no
5d_25C 10d_25C 0.866515 no
7d_25C 7d_15C 0.818533 no
7d_25C 7d_30C 0.605478 no
7d_25C 10d_25C 0.895186 no
7d_15C 7d_30C 0.843359 no
7d_15C 10d_25C 0.927142 no
7d_30C 10d_25C 0.736551 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2465.t1
MGEVTPTSGKKQIILNAFVMNTPGHLAPGLWKHPRNKTDQYKTLSFWTDLAQLLDKAGFHAMFIADTLGAYDVYK
GPRNVVPALASGAQFPVNDPLYLVPAMSAVTKNLIFGVTASVTYEKPYALARRLSTVDHLSQGRLAWNIVTSYLD
SAARNHGLNEQIPHDERYAIADEYLEVLYKLWEGSFRDDAVLADRQLGVYIASDGVREINHKGKYFDVPGPHFCE
PSPQRTPFLFQAGVSEAGNQFGGKHGEAIFIGGQTPEVARLTVDNIRNIAKQQGRDPKHIKVIVGINVIVAATDE
EAQAKREDYLQYADDEGALALFGGWTGIDLSSHSDDEDFLFSDSPRVQSIVRRFSGTVPGTDSLPWTKRRIVEYI
SVGGLQAKVVGSPTTVADELERWVEISDVDGFNLAHIVNPGTFEDIIEFLLPELRRRGLFREEIEKEGATAREVF
IGSQRLPEDHTGSKYKWRAGETIPQYQTKEI*
Coding >Pro_DTO377G3_2|g2465.t1
ATGGGTGAAGTCACACCAACGTCCGGCAAAAAGCAGATCATCCTCAATGCGTTCGTCATGAACACCCCGGGCCAT
TTGGCACCTGGGCTATGGAAGCACCCTAGAAACAAGACCGATCAGTACAAAACACTCTCATTCTGGACCGACTTA
GCTCAATTGCTGGACAAAGCCGGTTTCCATGCAATGTTCATTGCGGATACGCTGGGCGCGTACGATGTATACAAG
GGCCCTAGGAATGTGGTGCCCGCATTGGCATCCGGCGCACAATTTCCCGTCAATGACCCCTTGTATCTTGTTCCT
GCCATGTCCGCTGTCACAAAGAACCTTATTTTCGGAGTGACTGCCAGCGTGACGTATGAAAAACCATACGCCCTC
GCTCGCCGACTCTCTACCGTGGACCATCTCAGCCAAGGCCGTTTGGCATGGAACATTGTCACATCTTATCTGGAC
AGCGCAGCCCGAAACCACGGACTGAACGAGCAGATTCCTCACGACGAGCGATACGCAATAGCAGATGAATATCTT
GAGGTGCTCTATAAGCTCTGGGAAGGAAGTTTCCGAGACGACGCCGTGCTCGCCGACCGACAGCTCGGGGTATAC
ATTGCCAGCGATGGTGTGCGGGAGATAAACCACAAAGGAAAATACTTTGATGTTCCTGGCCCTCATTTCTGTGAG
CCATCGCCACAGCGTACGCCATTCCTGTTCCAGGCCGGCGTGTCCGAGGCCGGTAATCAATTCGGTGGAAAGCAT
GGTGAAGCAATCTTCATCGGTGGTCAGACTCCCGAGGTTGCTCGCTTAACGGTGGATAATATACGGAATATTGCC
AAACAGCAAGGCCGGGATCCCAAGCATATCAAAGTCATTGTGGGTATCAACGTGATTGTCGCAGCGACAGATGAA
GAAGCACAAGCAAAGCGCGAGGACTATCTCCAATATGCCGACGATGAAGGTGCGCTCGCTTTGTTCGGTGGATGG
ACCGGAATCGACCTGTCAAGTCATTCTGATGATGAGGATTTCCTGTTCAGCGACTCGCCGCGGGTCCAGTCCATT
GTTCGGAGATTCTCTGGTACCGTCCCTGGCACGGATAGCTTGCCATGGACTAAACGGAGGATCGTGGAGTATATC
AGTGTGGGTGGACTACAGGCCAAGGTTGTTGGCAGTCCTACGACAGTTGCAGATGAGTTGGAAAGATGGGTGGAA
ATATCCGATGTGGATGGCTTCAATCTTGCTCATATTGTGAATCCCGGGACTTTCGAGGATATCATTGAATTCTTA
TTGCCTGAACTAAGACGGAGAGGGCTGTTCCGAGAGGAAATTGAGAAAGAAGGTGCCACGGCTCGCGAGGTGTTC
ATTGGATCGCAACGTTTGCCTGAAGATCATACTGGAAGCAAATACAAGTGGCGAGCAGGGGAGACTATTCCTCAA
TATCAGACTAAGGAGATTTAG
Transcript >Pro_DTO377G3_2|g2465.t1
ATGGGTGAAGTCACACCAACGTCCGGCAAAAAGCAGATCATCCTCAATGCGTTCGTCATGAACACCCCGGGCCAT
TTGGCACCTGGGCTATGGAAGCACCCTAGAAACAAGACCGATCAGTACAAAACACTCTCATTCTGGACCGACTTA
GCTCAATTGCTGGACAAAGCCGGTTTCCATGCAATGTTCATTGCGGATACGCTGGGCGCGTACGATGTATACAAG
GGCCCTAGGAATGTGGTGCCCGCATTGGCATCCGGCGCACAATTTCCCGTCAATGACCCCTTGTATCTTGTTCCT
GCCATGTCCGCTGTCACAAAGAACCTTATTTTCGGAGTGACTGCCAGCGTGACGTATGAAAAACCATACGCCCTC
GCTCGCCGACTCTCTACCGTGGACCATCTCAGCCAAGGCCGTTTGGCATGGAACATTGTCACATCTTATCTGGAC
AGCGCAGCCCGAAACCACGGACTGAACGAGCAGATTCCTCACGACGAGCGATACGCAATAGCAGATGAATATCTT
GAGGTGCTCTATAAGCTCTGGGAAGGAAGTTTCCGAGACGACGCCGTGCTCGCCGACCGACAGCTCGGGGTATAC
ATTGCCAGCGATGGTGTGCGGGAGATAAACCACAAAGGAAAATACTTTGATGTTCCTGGCCCTCATTTCTGTGAG
CCATCGCCACAGCGTACGCCATTCCTGTTCCAGGCCGGCGTGTCCGAGGCCGGTAATCAATTCGGTGGAAAGCAT
GGTGAAGCAATCTTCATCGGTGGTCAGACTCCCGAGGTTGCTCGCTTAACGGTGGATAATATACGGAATATTGCC
AAACAGCAAGGCCGGGATCCCAAGCATATCAAAGTCATTGTGGGTATCAACGTGATTGTCGCAGCGACAGATGAA
GAAGCACAAGCAAAGCGCGAGGACTATCTCCAATATGCCGACGATGAAGGTGCGCTCGCTTTGTTCGGTGGATGG
ACCGGAATCGACCTGTCAAGTCATTCTGATGATGAGGATTTCCTGTTCAGCGACTCGCCGCGGGTCCAGTCCATT
GTTCGGAGATTCTCTGGTACCGTCCCTGGCACGGATAGCTTGCCATGGACTAAACGGAGGATCGTGGAGTATATC
AGTGTGGGTGGACTACAGGCCAAGGTTGTTGGCAGTCCTACGACAGTTGCAGATGAGTTGGAAAGATGGGTGGAA
ATATCCGATGTGGATGGCTTCAATCTTGCTCATATTGTGAATCCCGGGACTTTCGAGGATATCATTGAATTCTTA
TTGCCTGAACTAAGACGGAGAGGGCTGTTCCGAGAGGAAATTGAGAAAGAAGGTGCCACGGCTCGCGAGGTGTTC
ATTGGATCGCAACGTTTGCCTGAAGATCATACTGGAAGCAAATACAAGTGGCGAGCAGGGGAGACTATTCCTCAA
TATCAGACTAAGGAGATTTAG
Gene >Pro_DTO377G3_2|g2465.t1
ATGGGTGAAGTCACACCAACGTCCGGCAAAAAGCAGATCATCCTCAATGCGTTCGTCATGAACACCCCGGGCCAT
TTGGCACCTGGGCTATGGAAGCACCCTAGAAACAAGACCGATCAGTACAAAACACTCTCATTCTGGACCGACTTA
GCTCAATTGCTGGACAAAGCCGGTTTCCATGCAATGTTCATTGCGGATACGCTGGGCGCGTACGATGTATACAAG
GGCCCTAGGAATGTGGTGCCCGCATTGGCATCCGGCGCACAATTTCCCGTCAATGACCCCTTGTATCTTGTTCCT
GCCATGTCCGCTGTCACAAAGAACCTTATTTTCGGAGTGACTGCCAGCGTGACGTATGAAAAACCATACGCCCTC
GCTCGCCGACTCTCTACCGTGGACCATCTCAGCCAAGGCCGTTTGGCATGGAACATTGTCACATCTTATCTGGAC
AGCGCAGCCCGAAACCACGGACTGAACGAGCAGATTCCTCACGACGAGCGATACGCAATAGCAGATGAATATCTT
GAGGTGCTCTATAAGCTCTGGGAAGGAAGTTTCCGAGACGACGCCGTGCTCGCCGACCGACAGCTCGGGGTATAC
ATTGCCAGCGATGGTGTGCGGGAGATAAACCACAAAGGAAAATACTTTGATGTTCCTGGCCCTCATTTCTGTGAG
CCATCGCCACAGCGTACGCCATTCCTGTTCCAGGCCGGCGTGTCCGAGGCCGGTAATCAATTCGGTGGAAAGCAT
GGTGAAGCAATCTTCATCGGTGGTCAGACTCCCGAGGTTGCTCGCTTAACGGTGGATAATATACGGAATATTGCC
AAACAGCAAGGCCGGGATCCCAAGCATATCAAAGTCATTGTGGGTATCAACGTGATTGTCGCAGCGACAGATGAA
GAAGCACAAGCAAAGCGCGAGGACTATCTCCAATATGCCGACGATGAAGGTGCGCTCGCTTTGTTCGGTGGATGG
ACCGGAATCGACCTGTCAAGTCATTCTGATGATGAGGATTTCCTGTTCAGCGACTCGCCGCGGGTCCAGTCCATT
GTTCGGAGATTCTCTGGTACCGTCCCTGGCACGGATAGCTTGCCATGGACTAAACGGAGGATCGTGGAGTATATC
AGTGTGGGTGGACTACAGGCCAAGGTTGTTGGCAGTCCTACGACAGTTGCAGATGAGTTGGAAAGATGGGTGGAA
ATATCCGATGTGGATGGCTTCAATCTTGCTCATATTGTGAATCCCGGGACTTTCGAGGATATCATTGAATTCTTA
TTGCCTGAACTAAGACGGAGAGGGCTGTTCCGAGAGGAAATTGAGAAAGAAGGTGCCACGGCTCGCGAGGTGTTC
ATTGGATCGCAACGTTTGCCTGAAGATCATACTGGAAGCAAATACAAGTGGCGAGCAGGGGAGACTATTCCTCAA
TATCAGACTAAGGAGATTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail