Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2463.t1
Gene name
Locationscaffold_03:103964..104941
Strand-
Gene length (bp)977
Transcript length (bp)918
Coding sequence length (bp)918
Protein length (aa) 306

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.5

Transmembrane Domains

Domain # Start End Length
1 10 29 19
2 38 60 22
3 70 92 22
4 109 131 22
5 146 166 20
6 179 201 22
7 216 238 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 0.71 0.0 1.57
5d_25C Five days - 25 degrees Celsius 0.66 0.0 1.54
7d_25C Seven days - 25 degrees Celsius 0.27 0.0 0.73
10d_25C Ten days - 25 degrees Celsius 0.79 0.0 1.79
7d_15C Seven days - 15 degrees Celsius 0.69 0.0 1.54
7d_30C Seven days - 30 degrees Celsius 0.50 0.0 1.21

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.947085 no
3d_25C 7d_25C 0.335611 no
3d_25C 7d_15C 0.975841 no
3d_25C 7d_30C 0.720686 no
3d_25C 10d_25C 0.934727 no
5d_25C 7d_25C 1.000000 no
5d_25C 7d_15C 1.000000 no
5d_25C 7d_30C 1.000000 no
5d_25C 10d_25C 0.876241 no
7d_25C 7d_15C 1.000000 no
7d_25C 7d_30C 1.000000 no
7d_25C 10d_25C 0.297696 no
7d_15C 7d_30C 1.000000 no
7d_15C 10d_25C 0.898567 no
7d_30C 10d_25C 0.643945 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2463.t1
MTIDYRHGISILEVIVYSPCLFIALWMAFHHGFKKSSGWYFFNIFCLARVIGAACYLATIRYPSNINLYITWAVC
TSLGLSPLLLACLGLLSRANDSIMRKTANPLHPLIFRVVATFSLVGVILSIVGTTQNSDITHGFVTIESKIGLIF
YLITWFCVFGLFFLILKRTESIEDGERRLLLAVGISVPLILVRLVYSYIFAFGGDADFNLLSGNVTIQLVMCVLE
EILVVLVCLGIGLTLEVRPAAEYTQQLSTHSGEENMMELESGHLPGQARPNRRVQRPKRRGGPITKLVMYIVDEV
KDRKR*
Coding >Pro_DTO377G3_2|g2463.t1
ATGACTATCGATTATCGGCATGGGATTTCGATCCTAGAGGTCATTGTTTACTCTCCATGCCTCTTCATTGCTCTC
TGGATGGCATTCCACCATGGTTTCAAAAAAAGCTCCGGCTGGTACTTTTTCAACATCTTTTGTCTTGCCCGTGTC
ATTGGCGCAGCATGCTATTTGGCCACGATTCGCTATCCTTCCAATATCAATCTATATATTACCTGGGCTGTTTGC
ACTTCGCTTGGACTTTCACCGTTGTTATTGGCTTGCCTTGGTCTTTTATCCCGAGCAAATGATTCCATTATGCGA
AAGACCGCCAATCCTCTCCACCCGTTGATCTTCCGGGTTGTTGCAACATTTTCACTAGTCGGTGTGATTCTGAGC
ATTGTCGGCACAACCCAGAATTCCGATATTACCCATGGCTTTGTTACAATAGAGTCGAAGATTGGCCTCATATTC
TACCTTATTACCTGGTTCTGTGTGTTCGGGCTGTTCTTTCTGATCTTGAAACGAACGGAAAGTATTGAGGATGGA
GAACGTCGTCTCCTCTTGGCTGTGGGAATCTCCGTCCCCTTGATCCTCGTGCGATTAGTCTACTCTTACATCTTT
GCCTTTGGTGGAGATGCAGACTTCAATCTGCTGTCCGGAAATGTCACGATTCAGCTTGTGATGTGTGTTTTAGAG
GAAATTCTCGTTGTTCTTGTGTGCCTGGGCATCGGCCTTACACTTGAAGTACGACCCGCTGCTGAATACACACAG
CAACTCAGTACCCACAGCGGAGAGGAAAATATGATGGAGCTCGAGAGTGGTCACCTGCCAGGCCAAGCGCGTCCA
AATAGACGAGTCCAAAGACCCAAGCGTCGGGGTGGACCCATTACGAAACTCGTGATGTATATTGTGGATGAGGTC
AAGGACCGGAAGCGATGA
Transcript >Pro_DTO377G3_2|g2463.t1
ATGACTATCGATTATCGGCATGGGATTTCGATCCTAGAGGTCATTGTTTACTCTCCATGCCTCTTCATTGCTCTC
TGGATGGCATTCCACCATGGTTTCAAAAAAAGCTCCGGCTGGTACTTTTTCAACATCTTTTGTCTTGCCCGTGTC
ATTGGCGCAGCATGCTATTTGGCCACGATTCGCTATCCTTCCAATATCAATCTATATATTACCTGGGCTGTTTGC
ACTTCGCTTGGACTTTCACCGTTGTTATTGGCTTGCCTTGGTCTTTTATCCCGAGCAAATGATTCCATTATGCGA
AAGACCGCCAATCCTCTCCACCCGTTGATCTTCCGGGTTGTTGCAACATTTTCACTAGTCGGTGTGATTCTGAGC
ATTGTCGGCACAACCCAGAATTCCGATATTACCCATGGCTTTGTTACAATAGAGTCGAAGATTGGCCTCATATTC
TACCTTATTACCTGGTTCTGTGTGTTCGGGCTGTTCTTTCTGATCTTGAAACGAACGGAAAGTATTGAGGATGGA
GAACGTCGTCTCCTCTTGGCTGTGGGAATCTCCGTCCCCTTGATCCTCGTGCGATTAGTCTACTCTTACATCTTT
GCCTTTGGTGGAGATGCAGACTTCAATCTGCTGTCCGGAAATGTCACGATTCAGCTTGTGATGTGTGTTTTAGAG
GAAATTCTCGTTGTTCTTGTGTGCCTGGGCATCGGCCTTACACTTGAAGTACGACCCGCTGCTGAATACACACAG
CAACTCAGTACCCACAGCGGAGAGGAAAATATGATGGAGCTCGAGAGTGGTCACCTGCCAGGCCAAGCGCGTCCA
AATAGACGAGTCCAAAGACCCAAGCGTCGGGGTGGACCCATTACGAAACTCGTGATGTATATTGTGGATGAGGTC
AAGGACCGGAAGCGATGA
Gene >Pro_DTO377G3_2|g2463.t1
ATGACTATCGATTATCGGCATGGGATTTCGATCCTAGAGGTCATTGTTTACTCTCCATGCCTCTTCATTGCTCTC
TGGATGGCATTCCACCATGGTTTCAAAAAAAGCTCCGGCTGGTACTTTTTCAACATCTTTTGTCTTGCCCGTGTC
ATTGGCGCAGCATGCTATTTGGCCACGATTCGCTATCCTTCCAATATCAATCTATATATTACCTGGGCTGTTTGC
ACTTCGCTTGGACTTTCACCGTTGTTATTGGCTTGCCTTGGTCTTTTATCCCGAGCGTGAGCAACCCTCTTACTC
ATGATTAACTTGATGATTTGCAGCTAACGACATTTATTAGAAATGATTCCATTATGCGAAAGACCGCCAATCCTC
TCCACCCGTTGATCTTCCGGGTTGTTGCAACATTTTCACTAGTCGGTGTGATTCTGAGCATTGTCGGCACAACCC
AGAATTCCGATATTACCCATGGCTTTGTTACAATAGAGTCGAAGATTGGCCTCATATTCTACCTTATTACCTGGT
TCTGTGTGTTCGGGCTGTTCTTTCTGATCTTGAAACGAACGGAAAGTATTGAGGATGGAGAACGTCGTCTCCTCT
TGGCTGTGGGAATCTCCGTCCCCTTGATCCTCGTGCGATTAGTCTACTCTTACATCTTTGCCTTTGGTGGAGATG
CAGACTTCAATCTGCTGTCCGGAAATGTCACGATTCAGCTTGTGATGTGTGTTTTAGAGGAAATTCTCGTTGTTC
TTGTGTGCCTGGGCATCGGCCTTACACTTGAAGTACGACCCGCTGCTGAATACACACAGCAACTCAGTACCCACA
GCGGAGAGGAAAATATGATGGAGCTCGAGAGTGGTCACCTGCCAGGCCAAGCGCGTCCAAATAGACGAGTCCAAA
GACCCAAGCGTCGGGGTGGACCCATTACGAAACTCGTGATGTATATTGTGGATGAGGTCAAGGACCGGAAGCGAT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail