Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2454.t1
Gene name
Locationscaffold_03:74863..80878
Strand-
Gene length (bp)6015
Transcript length (bp)6015
Coding sequence length (bp)6015
Protein length (aa) 2005

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02889 Sec63 Sec63 Brl domain 1.5E-82 793 1097
PF02889 Sec63 Sec63 Brl domain 9.1E-48 1634 1977
PF00270 DEAD DEAD/DEAH box helicase 2.9E-26 284 466
PF00270 DEAD DEAD/DEAH box helicase 1.2E-22 1143 1306
PF04851 ResIII Type III restriction enzyme, res subunit 2.4E-08 289 465
PF04851 ResIII Type III restriction enzyme, res subunit 2.7E-11 1154 1275
PF00271 Helicase_C Helicase conserved C-terminal domain 2.2E-06 527 669
PF00271 Helicase_C Helicase conserved C-terminal domain 5.0E-07 1419 1506

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0005524 ATP binding Yes
GO:0003677 DNA binding Yes
GO:0003676 nucleic acid binding Yes
GO:0005488 binding No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0030554 adenyl nucleotide binding No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 19.94 12.25 27.63
5d_25C Five days - 25 degrees Celsius 22.10 13.57 30.62
7d_25C Seven days - 25 degrees Celsius 25.21 15.35 35.08
10d_25C Ten days - 25 degrees Celsius 23.91 14.64 33.18
7d_15C Seven days - 15 degrees Celsius 23.27 14.10 32.45
7d_30C Seven days - 30 degrees Celsius 21.83 13.37 30.29

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.711924 no
3d_25C 7d_25C 0.318614 no
3d_25C 7d_15C 0.546547 no
3d_25C 7d_30C 0.750298 no
3d_25C 10d_25C 0.458280 no
5d_25C 7d_25C 0.620675 no
5d_25C 7d_15C 0.865383 no
5d_25C 7d_30C 0.971097 no
5d_25C 10d_25C 0.785079 no
7d_25C 7d_15C 0.788925 no
7d_25C 7d_30C 0.582525 no
7d_25C 10d_25C 0.866807 no
7d_15C 7d_30C 0.834313 no
7d_15C 10d_25C 0.935862 no
7d_30C 10d_25C 0.748137 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2454.t1
MDSIAATESQWLLQLAAMRQAIADLKLPKDLPHEAIGYGSDIDLDIDDDYSSPGTNDDVWDIISSDDESSDDLDG
LDGLHVAPGSSYNRFWLEDKCQDLAMRNSTMDATELAGQVIATLAADSNDEELQMSLAEIVGFDDLDLVIELIAH
RGEILSDKGPCLESQTDGLMAGRLQTRAEREHALQQRDFEHKNAALMPAQTRSEPSYPHVFKQHTSGNTLSANGK
KYGLPLGSEQIEEPKYTEFAIPASKVGTLGKGRKLVEISEMDGLCRGTFKGYKALNRMQSLLYDVAYKTNENMLI
CAPTGAGKTDAAMLTVLNAVGKNTSPNPLENPEATEFTVQLDDFKIVYVAPMKALAAEVTEKLGKRLAWLGVKVR
ELTGDMQLTKREIVDTQIIVTTPEKWDVVTRKSTGDTELVQKVRLLIIDEVHMLHDERGAVIESLVARTQRQVES
TQSLIRIVGLSATLPNYTDVADFLKVNKMAGMFFFDQSFRPVPLEQHFIGVKGKPGSKQSRDNIDSVAYEKVRDM
MERGHQVMVFVHSRKDTVMTARMLMQLAAEEGREDLFSCHDHENYSNALRDMKHARARELRDLFASGFGTHHAGM
TRSDRNLMERMFTEGLIKVLCCTATLAWGVNLPAAAVVIKGTQLYNPQEGKFIDLSILDVMQIFGRAGRPQFQDT
GIGFICTTHDKLTHYLSAVTAQQPIESRFSGRLVDNLNAEISLGTVTSVSEAVQWLGYSYLYVRMKREPRNYGIE
FAELRDDPMLVQRRRQLILQAARVLQKSQMIIFNDKTEDLKAKDVGRIASQYYVLQTSVEIFNDMMRPRSGEADV
LKMISMSGEFDNIQSRDSESKELQRLREEVAQTEVAGGNDTPHAKTNLLLQAYISRAKIEDFALASDTGYVAQNA
ARICRALFMIALNRRWGYQCQVLLSLCKSIEKQIWPFDHPFRQFDLPQPILRNLDEKLPTTSIESMKEMEPAEIG
QLVNNHRMGNTLAKLLDNFPTLSVETEIAPLNRDVLRIRLSIYPEFTWNDRHHGASESFWVWVENSETSEIYHHE
YFILSRKKLYADHELNFTIPLSDPLPSQIYIRVISDRWLGAETVSPVSFQHLIRPDTESVYTDLLNLQPLPISAL
KNPILEEVYGQRFQFFNPMQTQIFHLLYHTPANVLLGSPTGSGKTIAAELAMWWAFREKPGSKVVYIAPMKALVR
ERVQDWRKRLTRQMGLKLVELTGDNTPDTRTIRDADIIVTTPEKWDGISRSWQTRDYVRKVSLVIIDEIHLLGGD
RGPILEIIVSRMNYIASQSKGSVRLMGMSTACANASDLANWLGVKEGLYNFRHSVRPVPLEIFIDGFPEQRGFCP
LMQSMNRPTFLAIKNHSPDKPVIVFVASRRQTRLTAKDLINYCGMEDNPRRFVRMSEDDLELNLARVKDDALKEA
LNFGIGLHHAGLVESDRQLAEELFANNKIQVLVATSTLAWGVNLPAHLVVVKGTQFFDAKIEGYRDMDLTDVLQM
LGRAGRPQFDTSGIARIFTQDSKKAFYKHFLHTGFPVESTLHKVLDNHLGAEVSAGTIGTQQDALDYLTWTFFFR
RLHKNPSYYGLEISAEEQNTMAAQATAQDFMVELVAKSLNDLAESSCVLVDSVTGEVDSTPFGKIMSYYYLSHKT
IRYLVSHAKRDPTFQDVLSWMCSATEFDELPVRHNEDLINAELAENLPLSIDCMGDAPLWDPHTKAFLLLQAYMS
RIDLPITDYVGDQTSVLDQGIRVIQASIDVMAELGYLPACQMLMTLLQCIKSARWPEDHPLSILPGIPTEKPPSG
LPGTLVSLSSQPVGAVAALVKKLNLPFNFTRITSQLPHLSVAIANVSAKGVAVSLTRRNQPTTPECKVYAPRFPK
PQTEGFFLIVCSALPNGMDGELLGLKRVSWPPVSKRNGNGKDKGNHGASSSRAGAAKDNKVDVLTVRSNIKFPEG
ILADSTSTSTARVNIRVISDSYVGMAWTLSNIEVNLDTGIDTQTVAEASVPTKD*
Coding >Pro_DTO377G3_2|g2454.t1
ATGGACAGCATCGCAGCTACCGAGTCACAATGGCTGTTACAACTAGCAGCCATGCGCCAGGCCATTGCCGATCTG
AAGCTCCCCAAGGACCTTCCTCATGAAGCGATCGGCTATGGAAGTGATATTGATCTGGATATTGACGACGACTAC
TCATCCCCGGGAACAAATGATGATGTGTGGGATATCATCAGCTCGGATGATGAATCTTCCGATGACCTGGATGGA
CTCGACGGACTTCATGTCGCACCAGGATCCTCCTACAATCGATTCTGGCTTGAAGATAAGTGCCAGGATTTGGCT
ATGCGGAACTCAACTATGGATGCGACGGAGCTTGCTGGGCAAGTCATCGCCACCCTGGCTGCTGACAGCAACGAC
GAAGAGCTACAAATGTCCTTGGCCGAGATTGTGGGATTCGATGACCTGGATCTGGTGATTGAGCTGATTGCACAC
AGAGGAGAAATTCTGTCGGACAAGGGACCCTGCTTGGAATCCCAGACAGATGGGCTCATGGCAGGTAGACTCCAA
ACACGAGCAGAGAGAGAACATGCTCTGCAGCAGCGCGACTTCGAACATAAGAATGCAGCGTTGATGCCGGCCCAA
ACCCGATCGGAGCCTTCCTACCCGCATGTTTTCAAACAACACACCTCTGGAAATACACTTTCCGCCAATGGAAAG
AAATATGGGCTGCCTCTGGGTAGTGAGCAGATTGAGGAACCAAAGTACACCGAATTCGCGATTCCAGCGTCGAAG
GTCGGAACACTTGGAAAAGGAAGGAAACTGGTGGAAATCTCTGAAATGGATGGCCTTTGTCGGGGTACCTTCAAG
GGCTACAAAGCCCTCAATCGTATGCAAAGCTTGCTCTACGATGTTGCATACAAAACCAACGAAAATATGCTCATT
TGCGCGCCGACTGGTGCGGGTAAAACGGATGCCGCCATGTTGACTGTTCTCAACGCCGTGGGAAAGAACACATCT
CCTAATCCGTTAGAAAACCCAGAAGCGACTGAGTTCACTGTCCAACTTGACGACTTTAAGATTGTCTATGTTGCT
CCCATGAAGGCTTTGGCTGCTGAGGTGACGGAGAAACTCGGAAAACGTTTAGCCTGGTTGGGGGTCAAGGTCCGC
GAACTGACTGGTGATATGCAGTTGACCAAGCGGGAGATCGTTGATACCCAGATCATCGTTACTACCCCTGAGAAA
TGGGATGTCGTAACGCGGAAAAGCACTGGAGATACAGAGCTTGTTCAGAAGGTCCGCCTTCTCATTATTGATGAA
GTCCACATGTTGCACGATGAGCGAGGAGCGGTCATCGAGTCCTTGGTCGCTCGAACCCAACGTCAGGTCGAAAGC
ACACAGTCTCTGATTCGTATTGTTGGTCTATCGGCTACCCTTCCGAACTATACTGATGTGGCGGATTTCTTGAAA
GTAAACAAAATGGCCGGCATGTTCTTCTTTGATCAATCATTCCGGCCCGTACCCCTTGAGCAACACTTCATCGGT
GTTAAAGGGAAGCCCGGCTCCAAACAATCTCGTGACAACATTGACTCCGTCGCCTATGAGAAGGTTCGCGACATG
ATGGAGCGAGGCCACCAAGTCATGGTTTTCGTCCACTCACGCAAAGATACCGTAATGACTGCCAGGATGCTTATG
CAGCTAGCCGCGGAGGAGGGTCGAGAGGATTTATTCAGCTGTCATGATCACGAAAACTATTCGAATGCCCTTCGT
GATATGAAGCATGCCCGTGCGCGTGAACTGCGCGACCTTTTCGCTAGCGGATTTGGAACCCATCATGCTGGAATG
ACTCGAAGCGACCGCAATCTGATGGAGCGAATGTTTACAGAAGGTCTAATCAAGGTGCTGTGCTGTACTGCTACC
TTGGCGTGGGGTGTTAACCTCCCCGCAGCCGCAGTTGTTATCAAAGGTACTCAGTTGTATAACCCCCAAGAGGGT
AAATTCATTGACCTGAGCATTCTCGATGTCATGCAAATCTTTGGTCGTGCAGGTCGTCCACAATTTCAGGACACC
GGTATTGGATTTATCTGTACTACTCATGACAAGTTGACTCACTACCTGTCTGCGGTGACTGCGCAGCAGCCCATT
GAGTCGCGGTTTTCTGGTCGACTTGTGGATAACTTGAATGCCGAAATCTCACTTGGAACAGTCACATCTGTTTCA
GAGGCTGTGCAATGGCTTGGCTACTCGTATCTCTATGTTCGCATGAAACGTGAGCCGAGAAACTACGGAATCGAG
TTTGCCGAGTTGCGCGATGATCCAATGCTTGTCCAAAGGCGTAGGCAGTTGATCTTGCAAGCAGCACGAGTGCTA
CAAAAGAGTCAGATGATCATCTTCAACGACAAGACCGAAGATCTCAAAGCCAAGGATGTTGGTCGTATCGCGAGT
CAATATTATGTATTACAAACCAGTGTCGAGATTTTCAACGACATGATGCGCCCCCGATCCGGTGAGGCAGATGTA
CTCAAGATGATCAGTATGAGTGGAGAATTCGACAACATCCAATCCAGAGACAGCGAGTCGAAAGAGCTTCAGCGA
CTGCGCGAAGAAGTTGCGCAGACTGAAGTTGCCGGAGGAAATGACACGCCACACGCAAAGACAAATCTCTTGTTG
CAAGCTTACATCTCTCGCGCCAAAATTGAGGACTTTGCTTTAGCATCCGATACTGGGTATGTTGCGCAAAATGCG
GCACGTATCTGCCGTGCTCTCTTCATGATCGCGTTGAATCGTCGCTGGGGCTATCAATGCCAGGTTTTATTGTCT
CTTTGCAAGTCCATTGAGAAACAAATATGGCCCTTTGATCACCCTTTCCGGCAGTTCGACTTGCCTCAGCCGATC
CTACGTAACCTCGACGAAAAGCTTCCGACTACTTCCATCGAGTCCATGAAAGAAATGGAGCCTGCGGAGATTGGT
CAGCTTGTTAATAACCACCGCATGGGCAACACATTGGCCAAGCTCTTGGACAATTTCCCGACTCTGAGCGTCGAG
ACTGAGATTGCGCCGCTCAATCGCGATGTGCTTCGTATTCGCCTTTCCATCTACCCTGAGTTCACCTGGAATGAC
CGTCACCATGGAGCATCCGAATCCTTCTGGGTCTGGGTCGAGAACTCGGAAACATCAGAAATCTATCATCACGAG
TACTTCATCCTAAGTCGGAAGAAGCTTTATGCTGACCATGAGCTTAACTTCACTATTCCGCTGTCTGATCCCCTT
CCCAGCCAAATTTACATTCGTGTAATCTCCGACCGCTGGCTGGGTGCCGAAACCGTTAGCCCGGTTTCTTTCCAG
CACCTCATTCGCCCGGACACTGAAAGTGTGTATACTGATCTACTCAATCTCCAGCCACTTCCTATATCTGCTCTC
AAGAATCCCATTCTTGAGGAAGTGTATGGACAACGATTCCAATTCTTCAACCCTATGCAAACACAGATCTTCCAT
CTCCTTTACCACACACCAGCCAACGTTCTCCTTGGTTCCCCAACTGGCAGTGGAAAGACTATTGCAGCCGAGCTC
GCAATGTGGTGGGCTTTCCGTGAGAAGCCTGGCTCCAAGGTTGTCTACATTGCACCCATGAAGGCCTTGGTCCGT
GAACGAGTTCAAGATTGGCGTAAGCGTCTCACTAGGCAGATGGGCTTGAAGCTTGTTGAGTTGACCGGTGACAAT
ACGCCTGATACACGTACCATTCGAGATGCGGATATTATTGTCACCACGCCTGAGAAATGGGACGGTATATCACGT
AGTTGGCAGACCCGTGACTACGTCAGGAAAGTCAGCCTCGTGATTATTGATGAGATTCACTTGCTCGGTGGTGAT
CGTGGTCCCATTTTGGAAATCATTGTTTCCCGAATGAACTATATCGCTTCTCAATCCAAAGGATCCGTTCGACTG
ATGGGCATGTCCACCGCCTGTGCCAATGCTTCGGATCTAGCCAACTGGCTTGGTGTCAAAGAAGGACTGTATAAC
TTCCGCCATTCAGTTCGCCCAGTCCCCCTCGAGATTTTCATCGATGGGTTCCCTGAACAGCGTGGTTTCTGTCCC
TTGATGCAGTCAATGAATCGCCCAACCTTCCTCGCGATCAAGAACCATTCTCCAGATAAGCCAGTCATTGTCTTC
GTTGCTTCTCGACGACAAACTCGTTTGACTGCTAAGGATTTGATTAACTACTGTGGTATGGAGGACAATCCTCGT
CGATTCGTACGAATGTCTGAAGATGATCTGGAGTTGAATCTCGCGCGAGTGAAAGATGATGCTCTAAAAGAAGCC
CTCAACTTTGGTATTGGTCTGCATCATGCTGGTTTAGTTGAATCTGATCGTCAGCTGGCAGAAGAACTCTTTGCC
AACAACAAGATCCAAGTTCTGGTCGCGACCAGTACTCTTGCATGGGGTGTTAACCTTCCAGCGCATCTTGTGGTG
GTCAAAGGCACACAGTTCTTCGACGCTAAAATCGAAGGTTATCGGGATATGGACTTGACCGACGTTCTGCAAATG
CTCGGTCGTGCCGGTCGGCCGCAGTTTGACACATCCGGTATTGCACGCATCTTCACGCAGGACTCAAAGAAGGCT
TTCTACAAGCACTTCCTCCACACCGGTTTCCCCGTTGAGTCGACACTTCACAAGGTCCTCGATAACCATCTTGGC
GCTGAGGTATCTGCTGGAACTATTGGAACGCAACAAGATGCACTGGACTACTTGACCTGGACATTCTTCTTCCGT
CGATTGCACAAGAACCCGTCATATTACGGTCTCGAGATCTCTGCAGAGGAACAAAACACCATGGCAGCTCAGGCC
ACAGCTCAAGATTTCATGGTTGAATTGGTCGCAAAGTCGCTCAATGATCTCGCAGAATCGTCCTGTGTTCTCGTG
GACTCGGTCACCGGAGAGGTCGATTCCACTCCCTTCGGCAAGATCATGAGTTACTACTACCTGTCACATAAGACG
ATCCGGTACCTCGTGTCCCATGCCAAGCGTGATCCGACTTTCCAGGATGTCTTGAGCTGGATGTGCTCTGCCACC
GAATTCGACGAGCTGCCTGTCAGACACAATGAAGATCTGATCAACGCTGAGTTGGCCGAGAACTTGCCGCTTTCT
ATTGACTGCATGGGCGACGCGCCCCTATGGGACCCACACACCAAGGCCTTCCTCCTCCTGCAGGCCTACATGTCA
CGGATCGATCTTCCCATCACTGATTATGTTGGCGATCAGACATCTGTGCTCGATCAAGGTATTCGTGTCATCCAG
GCCTCAATCGATGTCATGGCTGAGCTCGGGTATCTTCCTGCGTGTCAGATGCTCATGACCCTCCTACAATGCATC
AAGTCGGCGCGCTGGCCTGAAGACCACCCATTGTCGATTCTGCCAGGCATTCCGACCGAGAAGCCACCTAGTGGT
CTCCCGGGAACTCTTGTATCGCTCTCGTCACAGCCTGTTGGTGCAGTCGCCGCTCTGGTGAAGAAATTAAATCTT
CCATTTAACTTCACTCGCATTACGTCCCAGCTGCCTCATCTGTCGGTCGCCATTGCAAATGTTTCTGCTAAGGGC
GTGGCTGTGTCTTTGACACGGCGTAACCAGCCCACAACCCCAGAATGCAAGGTCTACGCTCCTCGATTCCCCAAA
CCACAAACTGAGGGCTTCTTCTTGATTGTCTGCAGTGCTCTTCCCAATGGGATGGATGGTGAATTACTTGGCCTG
AAGCGTGTTTCTTGGCCACCAGTGTCTAAGCGCAATGGAAACGGCAAGGACAAGGGCAACCATGGTGCTAGTTCC
AGTCGCGCAGGAGCTGCCAAAGATAACAAGGTTGACGTGTTGACCGTTCGCTCAAATATTAAATTCCCCGAAGGC
ATCCTCGCGGATTCCACGAGTACGAGCACAGCTCGGGTGAATATCAGAGTCATCAGTGACTCGTACGTTGGGATG
GCATGGACTCTTTCCAATATCGAAGTTAATTTGGATACTGGCATCGATACGCAGACTGTGGCGGAGGCCAGCGTT
CCAACGAAGGACTAA
Transcript >Pro_DTO377G3_2|g2454.t1
ATGGACAGCATCGCAGCTACCGAGTCACAATGGCTGTTACAACTAGCAGCCATGCGCCAGGCCATTGCCGATCTG
AAGCTCCCCAAGGACCTTCCTCATGAAGCGATCGGCTATGGAAGTGATATTGATCTGGATATTGACGACGACTAC
TCATCCCCGGGAACAAATGATGATGTGTGGGATATCATCAGCTCGGATGATGAATCTTCCGATGACCTGGATGGA
CTCGACGGACTTCATGTCGCACCAGGATCCTCCTACAATCGATTCTGGCTTGAAGATAAGTGCCAGGATTTGGCT
ATGCGGAACTCAACTATGGATGCGACGGAGCTTGCTGGGCAAGTCATCGCCACCCTGGCTGCTGACAGCAACGAC
GAAGAGCTACAAATGTCCTTGGCCGAGATTGTGGGATTCGATGACCTGGATCTGGTGATTGAGCTGATTGCACAC
AGAGGAGAAATTCTGTCGGACAAGGGACCCTGCTTGGAATCCCAGACAGATGGGCTCATGGCAGGTAGACTCCAA
ACACGAGCAGAGAGAGAACATGCTCTGCAGCAGCGCGACTTCGAACATAAGAATGCAGCGTTGATGCCGGCCCAA
ACCCGATCGGAGCCTTCCTACCCGCATGTTTTCAAACAACACACCTCTGGAAATACACTTTCCGCCAATGGAAAG
AAATATGGGCTGCCTCTGGGTAGTGAGCAGATTGAGGAACCAAAGTACACCGAATTCGCGATTCCAGCGTCGAAG
GTCGGAACACTTGGAAAAGGAAGGAAACTGGTGGAAATCTCTGAAATGGATGGCCTTTGTCGGGGTACCTTCAAG
GGCTACAAAGCCCTCAATCGTATGCAAAGCTTGCTCTACGATGTTGCATACAAAACCAACGAAAATATGCTCATT
TGCGCGCCGACTGGTGCGGGTAAAACGGATGCCGCCATGTTGACTGTTCTCAACGCCGTGGGAAAGAACACATCT
CCTAATCCGTTAGAAAACCCAGAAGCGACTGAGTTCACTGTCCAACTTGACGACTTTAAGATTGTCTATGTTGCT
CCCATGAAGGCTTTGGCTGCTGAGGTGACGGAGAAACTCGGAAAACGTTTAGCCTGGTTGGGGGTCAAGGTCCGC
GAACTGACTGGTGATATGCAGTTGACCAAGCGGGAGATCGTTGATACCCAGATCATCGTTACTACCCCTGAGAAA
TGGGATGTCGTAACGCGGAAAAGCACTGGAGATACAGAGCTTGTTCAGAAGGTCCGCCTTCTCATTATTGATGAA
GTCCACATGTTGCACGATGAGCGAGGAGCGGTCATCGAGTCCTTGGTCGCTCGAACCCAACGTCAGGTCGAAAGC
ACACAGTCTCTGATTCGTATTGTTGGTCTATCGGCTACCCTTCCGAACTATACTGATGTGGCGGATTTCTTGAAA
GTAAACAAAATGGCCGGCATGTTCTTCTTTGATCAATCATTCCGGCCCGTACCCCTTGAGCAACACTTCATCGGT
GTTAAAGGGAAGCCCGGCTCCAAACAATCTCGTGACAACATTGACTCCGTCGCCTATGAGAAGGTTCGCGACATG
ATGGAGCGAGGCCACCAAGTCATGGTTTTCGTCCACTCACGCAAAGATACCGTAATGACTGCCAGGATGCTTATG
CAGCTAGCCGCGGAGGAGGGTCGAGAGGATTTATTCAGCTGTCATGATCACGAAAACTATTCGAATGCCCTTCGT
GATATGAAGCATGCCCGTGCGCGTGAACTGCGCGACCTTTTCGCTAGCGGATTTGGAACCCATCATGCTGGAATG
ACTCGAAGCGACCGCAATCTGATGGAGCGAATGTTTACAGAAGGTCTAATCAAGGTGCTGTGCTGTACTGCTACC
TTGGCGTGGGGTGTTAACCTCCCCGCAGCCGCAGTTGTTATCAAAGGTACTCAGTTGTATAACCCCCAAGAGGGT
AAATTCATTGACCTGAGCATTCTCGATGTCATGCAAATCTTTGGTCGTGCAGGTCGTCCACAATTTCAGGACACC
GGTATTGGATTTATCTGTACTACTCATGACAAGTTGACTCACTACCTGTCTGCGGTGACTGCGCAGCAGCCCATT
GAGTCGCGGTTTTCTGGTCGACTTGTGGATAACTTGAATGCCGAAATCTCACTTGGAACAGTCACATCTGTTTCA
GAGGCTGTGCAATGGCTTGGCTACTCGTATCTCTATGTTCGCATGAAACGTGAGCCGAGAAACTACGGAATCGAG
TTTGCCGAGTTGCGCGATGATCCAATGCTTGTCCAAAGGCGTAGGCAGTTGATCTTGCAAGCAGCACGAGTGCTA
CAAAAGAGTCAGATGATCATCTTCAACGACAAGACCGAAGATCTCAAAGCCAAGGATGTTGGTCGTATCGCGAGT
CAATATTATGTATTACAAACCAGTGTCGAGATTTTCAACGACATGATGCGCCCCCGATCCGGTGAGGCAGATGTA
CTCAAGATGATCAGTATGAGTGGAGAATTCGACAACATCCAATCCAGAGACAGCGAGTCGAAAGAGCTTCAGCGA
CTGCGCGAAGAAGTTGCGCAGACTGAAGTTGCCGGAGGAAATGACACGCCACACGCAAAGACAAATCTCTTGTTG
CAAGCTTACATCTCTCGCGCCAAAATTGAGGACTTTGCTTTAGCATCCGATACTGGGTATGTTGCGCAAAATGCG
GCACGTATCTGCCGTGCTCTCTTCATGATCGCGTTGAATCGTCGCTGGGGCTATCAATGCCAGGTTTTATTGTCT
CTTTGCAAGTCCATTGAGAAACAAATATGGCCCTTTGATCACCCTTTCCGGCAGTTCGACTTGCCTCAGCCGATC
CTACGTAACCTCGACGAAAAGCTTCCGACTACTTCCATCGAGTCCATGAAAGAAATGGAGCCTGCGGAGATTGGT
CAGCTTGTTAATAACCACCGCATGGGCAACACATTGGCCAAGCTCTTGGACAATTTCCCGACTCTGAGCGTCGAG
ACTGAGATTGCGCCGCTCAATCGCGATGTGCTTCGTATTCGCCTTTCCATCTACCCTGAGTTCACCTGGAATGAC
CGTCACCATGGAGCATCCGAATCCTTCTGGGTCTGGGTCGAGAACTCGGAAACATCAGAAATCTATCATCACGAG
TACTTCATCCTAAGTCGGAAGAAGCTTTATGCTGACCATGAGCTTAACTTCACTATTCCGCTGTCTGATCCCCTT
CCCAGCCAAATTTACATTCGTGTAATCTCCGACCGCTGGCTGGGTGCCGAAACCGTTAGCCCGGTTTCTTTCCAG
CACCTCATTCGCCCGGACACTGAAAGTGTGTATACTGATCTACTCAATCTCCAGCCACTTCCTATATCTGCTCTC
AAGAATCCCATTCTTGAGGAAGTGTATGGACAACGATTCCAATTCTTCAACCCTATGCAAACACAGATCTTCCAT
CTCCTTTACCACACACCAGCCAACGTTCTCCTTGGTTCCCCAACTGGCAGTGGAAAGACTATTGCAGCCGAGCTC
GCAATGTGGTGGGCTTTCCGTGAGAAGCCTGGCTCCAAGGTTGTCTACATTGCACCCATGAAGGCCTTGGTCCGT
GAACGAGTTCAAGATTGGCGTAAGCGTCTCACTAGGCAGATGGGCTTGAAGCTTGTTGAGTTGACCGGTGACAAT
ACGCCTGATACACGTACCATTCGAGATGCGGATATTATTGTCACCACGCCTGAGAAATGGGACGGTATATCACGT
AGTTGGCAGACCCGTGACTACGTCAGGAAAGTCAGCCTCGTGATTATTGATGAGATTCACTTGCTCGGTGGTGAT
CGTGGTCCCATTTTGGAAATCATTGTTTCCCGAATGAACTATATCGCTTCTCAATCCAAAGGATCCGTTCGACTG
ATGGGCATGTCCACCGCCTGTGCCAATGCTTCGGATCTAGCCAACTGGCTTGGTGTCAAAGAAGGACTGTATAAC
TTCCGCCATTCAGTTCGCCCAGTCCCCCTCGAGATTTTCATCGATGGGTTCCCTGAACAGCGTGGTTTCTGTCCC
TTGATGCAGTCAATGAATCGCCCAACCTTCCTCGCGATCAAGAACCATTCTCCAGATAAGCCAGTCATTGTCTTC
GTTGCTTCTCGACGACAAACTCGTTTGACTGCTAAGGATTTGATTAACTACTGTGGTATGGAGGACAATCCTCGT
CGATTCGTACGAATGTCTGAAGATGATCTGGAGTTGAATCTCGCGCGAGTGAAAGATGATGCTCTAAAAGAAGCC
CTCAACTTTGGTATTGGTCTGCATCATGCTGGTTTAGTTGAATCTGATCGTCAGCTGGCAGAAGAACTCTTTGCC
AACAACAAGATCCAAGTTCTGGTCGCGACCAGTACTCTTGCATGGGGTGTTAACCTTCCAGCGCATCTTGTGGTG
GTCAAAGGCACACAGTTCTTCGACGCTAAAATCGAAGGTTATCGGGATATGGACTTGACCGACGTTCTGCAAATG
CTCGGTCGTGCCGGTCGGCCGCAGTTTGACACATCCGGTATTGCACGCATCTTCACGCAGGACTCAAAGAAGGCT
TTCTACAAGCACTTCCTCCACACCGGTTTCCCCGTTGAGTCGACACTTCACAAGGTCCTCGATAACCATCTTGGC
GCTGAGGTATCTGCTGGAACTATTGGAACGCAACAAGATGCACTGGACTACTTGACCTGGACATTCTTCTTCCGT
CGATTGCACAAGAACCCGTCATATTACGGTCTCGAGATCTCTGCAGAGGAACAAAACACCATGGCAGCTCAGGCC
ACAGCTCAAGATTTCATGGTTGAATTGGTCGCAAAGTCGCTCAATGATCTCGCAGAATCGTCCTGTGTTCTCGTG
GACTCGGTCACCGGAGAGGTCGATTCCACTCCCTTCGGCAAGATCATGAGTTACTACTACCTGTCACATAAGACG
ATCCGGTACCTCGTGTCCCATGCCAAGCGTGATCCGACTTTCCAGGATGTCTTGAGCTGGATGTGCTCTGCCACC
GAATTCGACGAGCTGCCTGTCAGACACAATGAAGATCTGATCAACGCTGAGTTGGCCGAGAACTTGCCGCTTTCT
ATTGACTGCATGGGCGACGCGCCCCTATGGGACCCACACACCAAGGCCTTCCTCCTCCTGCAGGCCTACATGTCA
CGGATCGATCTTCCCATCACTGATTATGTTGGCGATCAGACATCTGTGCTCGATCAAGGTATTCGTGTCATCCAG
GCCTCAATCGATGTCATGGCTGAGCTCGGGTATCTTCCTGCGTGTCAGATGCTCATGACCCTCCTACAATGCATC
AAGTCGGCGCGCTGGCCTGAAGACCACCCATTGTCGATTCTGCCAGGCATTCCGACCGAGAAGCCACCTAGTGGT
CTCCCGGGAACTCTTGTATCGCTCTCGTCACAGCCTGTTGGTGCAGTCGCCGCTCTGGTGAAGAAATTAAATCTT
CCATTTAACTTCACTCGCATTACGTCCCAGCTGCCTCATCTGTCGGTCGCCATTGCAAATGTTTCTGCTAAGGGC
GTGGCTGTGTCTTTGACACGGCGTAACCAGCCCACAACCCCAGAATGCAAGGTCTACGCTCCTCGATTCCCCAAA
CCACAAACTGAGGGCTTCTTCTTGATTGTCTGCAGTGCTCTTCCCAATGGGATGGATGGTGAATTACTTGGCCTG
AAGCGTGTTTCTTGGCCACCAGTGTCTAAGCGCAATGGAAACGGCAAGGACAAGGGCAACCATGGTGCTAGTTCC
AGTCGCGCAGGAGCTGCCAAAGATAACAAGGTTGACGTGTTGACCGTTCGCTCAAATATTAAATTCCCCGAAGGC
ATCCTCGCGGATTCCACGAGTACGAGCACAGCTCGGGTGAATATCAGAGTCATCAGTGACTCGTACGTTGGGATG
GCATGGACTCTTTCCAATATCGAAGTTAATTTGGATACTGGCATCGATACGCAGACTGTGGCGGAGGCCAGCGTT
CCAACGAAGGACTAA
Gene >Pro_DTO377G3_2|g2454.t1
ATGGACAGCATCGCAGCTACCGAGTCACAATGGCTGTTACAACTAGCAGCCATGCGCCAGGCCATTGCCGATCTG
AAGCTCCCCAAGGACCTTCCTCATGAAGCGATCGGCTATGGAAGTGATATTGATCTGGATATTGACGACGACTAC
TCATCCCCGGGAACAAATGATGATGTGTGGGATATCATCAGCTCGGATGATGAATCTTCCGATGACCTGGATGGA
CTCGACGGACTTCATGTCGCACCAGGATCCTCCTACAATCGATTCTGGCTTGAAGATAAGTGCCAGGATTTGGCT
ATGCGGAACTCAACTATGGATGCGACGGAGCTTGCTGGGCAAGTCATCGCCACCCTGGCTGCTGACAGCAACGAC
GAAGAGCTACAAATGTCCTTGGCCGAGATTGTGGGATTCGATGACCTGGATCTGGTGATTGAGCTGATTGCACAC
AGAGGAGAAATTCTGTCGGACAAGGGACCCTGCTTGGAATCCCAGACAGATGGGCTCATGGCAGGTAGACTCCAA
ACACGAGCAGAGAGAGAACATGCTCTGCAGCAGCGCGACTTCGAACATAAGAATGCAGCGTTGATGCCGGCCCAA
ACCCGATCGGAGCCTTCCTACCCGCATGTTTTCAAACAACACACCTCTGGAAATACACTTTCCGCCAATGGAAAG
AAATATGGGCTGCCTCTGGGTAGTGAGCAGATTGAGGAACCAAAGTACACCGAATTCGCGATTCCAGCGTCGAAG
GTCGGAACACTTGGAAAAGGAAGGAAACTGGTGGAAATCTCTGAAATGGATGGCCTTTGTCGGGGTACCTTCAAG
GGCTACAAAGCCCTCAATCGTATGCAAAGCTTGCTCTACGATGTTGCATACAAAACCAACGAAAATATGCTCATT
TGCGCGCCGACTGGTGCGGGTAAAACGGATGCCGCCATGTTGACTGTTCTCAACGCCGTGGGAAAGAACACATCT
CCTAATCCGTTAGAAAACCCAGAAGCGACTGAGTTCACTGTCCAACTTGACGACTTTAAGATTGTCTATGTTGCT
CCCATGAAGGCTTTGGCTGCTGAGGTGACGGAGAAACTCGGAAAACGTTTAGCCTGGTTGGGGGTCAAGGTCCGC
GAACTGACTGGTGATATGCAGTTGACCAAGCGGGAGATCGTTGATACCCAGATCATCGTTACTACCCCTGAGAAA
TGGGATGTCGTAACGCGGAAAAGCACTGGAGATACAGAGCTTGTTCAGAAGGTCCGCCTTCTCATTATTGATGAA
GTCCACATGTTGCACGATGAGCGAGGAGCGGTCATCGAGTCCTTGGTCGCTCGAACCCAACGTCAGGTCGAAAGC
ACACAGTCTCTGATTCGTATTGTTGGTCTATCGGCTACCCTTCCGAACTATACTGATGTGGCGGATTTCTTGAAA
GTAAACAAAATGGCCGGCATGTTCTTCTTTGATCAATCATTCCGGCCCGTACCCCTTGAGCAACACTTCATCGGT
GTTAAAGGGAAGCCCGGCTCCAAACAATCTCGTGACAACATTGACTCCGTCGCCTATGAGAAGGTTCGCGACATG
ATGGAGCGAGGCCACCAAGTCATGGTTTTCGTCCACTCACGCAAAGATACCGTAATGACTGCCAGGATGCTTATG
CAGCTAGCCGCGGAGGAGGGTCGAGAGGATTTATTCAGCTGTCATGATCACGAAAACTATTCGAATGCCCTTCGT
GATATGAAGCATGCCCGTGCGCGTGAACTGCGCGACCTTTTCGCTAGCGGATTTGGAACCCATCATGCTGGAATG
ACTCGAAGCGACCGCAATCTGATGGAGCGAATGTTTACAGAAGGTCTAATCAAGGTGCTGTGCTGTACTGCTACC
TTGGCGTGGGGTGTTAACCTCCCCGCAGCCGCAGTTGTTATCAAAGGTACTCAGTTGTATAACCCCCAAGAGGGT
AAATTCATTGACCTGAGCATTCTCGATGTCATGCAAATCTTTGGTCGTGCAGGTCGTCCACAATTTCAGGACACC
GGTATTGGATTTATCTGTACTACTCATGACAAGTTGACTCACTACCTGTCTGCGGTGACTGCGCAGCAGCCCATT
GAGTCGCGGTTTTCTGGTCGACTTGTGGATAACTTGAATGCCGAAATCTCACTTGGAACAGTCACATCTGTTTCA
GAGGCTGTGCAATGGCTTGGCTACTCGTATCTCTATGTTCGCATGAAACGTGAGCCGAGAAACTACGGAATCGAG
TTTGCCGAGTTGCGCGATGATCCAATGCTTGTCCAAAGGCGTAGGCAGTTGATCTTGCAAGCAGCACGAGTGCTA
CAAAAGAGTCAGATGATCATCTTCAACGACAAGACCGAAGATCTCAAAGCCAAGGATGTTGGTCGTATCGCGAGT
CAATATTATGTATTACAAACCAGTGTCGAGATTTTCAACGACATGATGCGCCCCCGATCCGGTGAGGCAGATGTA
CTCAAGATGATCAGTATGAGTGGAGAATTCGACAACATCCAATCCAGAGACAGCGAGTCGAAAGAGCTTCAGCGA
CTGCGCGAAGAAGTTGCGCAGACTGAAGTTGCCGGAGGAAATGACACGCCACACGCAAAGACAAATCTCTTGTTG
CAAGCTTACATCTCTCGCGCCAAAATTGAGGACTTTGCTTTAGCATCCGATACTGGGTATGTTGCGCAAAATGCG
GCACGTATCTGCCGTGCTCTCTTCATGATCGCGTTGAATCGTCGCTGGGGCTATCAATGCCAGGTTTTATTGTCT
CTTTGCAAGTCCATTGAGAAACAAATATGGCCCTTTGATCACCCTTTCCGGCAGTTCGACTTGCCTCAGCCGATC
CTACGTAACCTCGACGAAAAGCTTCCGACTACTTCCATCGAGTCCATGAAAGAAATGGAGCCTGCGGAGATTGGT
CAGCTTGTTAATAACCACCGCATGGGCAACACATTGGCCAAGCTCTTGGACAATTTCCCGACTCTGAGCGTCGAG
ACTGAGATTGCGCCGCTCAATCGCGATGTGCTTCGTATTCGCCTTTCCATCTACCCTGAGTTCACCTGGAATGAC
CGTCACCATGGAGCATCCGAATCCTTCTGGGTCTGGGTCGAGAACTCGGAAACATCAGAAATCTATCATCACGAG
TACTTCATCCTAAGTCGGAAGAAGCTTTATGCTGACCATGAGCTTAACTTCACTATTCCGCTGTCTGATCCCCTT
CCCAGCCAAATTTACATTCGTGTAATCTCCGACCGCTGGCTGGGTGCCGAAACCGTTAGCCCGGTTTCTTTCCAG
CACCTCATTCGCCCGGACACTGAAAGTGTGTATACTGATCTACTCAATCTCCAGCCACTTCCTATATCTGCTCTC
AAGAATCCCATTCTTGAGGAAGTGTATGGACAACGATTCCAATTCTTCAACCCTATGCAAACACAGATCTTCCAT
CTCCTTTACCACACACCAGCCAACGTTCTCCTTGGTTCCCCAACTGGCAGTGGAAAGACTATTGCAGCCGAGCTC
GCAATGTGGTGGGCTTTCCGTGAGAAGCCTGGCTCCAAGGTTGTCTACATTGCACCCATGAAGGCCTTGGTCCGT
GAACGAGTTCAAGATTGGCGTAAGCGTCTCACTAGGCAGATGGGCTTGAAGCTTGTTGAGTTGACCGGTGACAAT
ACGCCTGATACACGTACCATTCGAGATGCGGATATTATTGTCACCACGCCTGAGAAATGGGACGGTATATCACGT
AGTTGGCAGACCCGTGACTACGTCAGGAAAGTCAGCCTCGTGATTATTGATGAGATTCACTTGCTCGGTGGTGAT
CGTGGTCCCATTTTGGAAATCATTGTTTCCCGAATGAACTATATCGCTTCTCAATCCAAAGGATCCGTTCGACTG
ATGGGCATGTCCACCGCCTGTGCCAATGCTTCGGATCTAGCCAACTGGCTTGGTGTCAAAGAAGGACTGTATAAC
TTCCGCCATTCAGTTCGCCCAGTCCCCCTCGAGATTTTCATCGATGGGTTCCCTGAACAGCGTGGTTTCTGTCCC
TTGATGCAGTCAATGAATCGCCCAACCTTCCTCGCGATCAAGAACCATTCTCCAGATAAGCCAGTCATTGTCTTC
GTTGCTTCTCGACGACAAACTCGTTTGACTGCTAAGGATTTGATTAACTACTGTGGTATGGAGGACAATCCTCGT
CGATTCGTACGAATGTCTGAAGATGATCTGGAGTTGAATCTCGCGCGAGTGAAAGATGATGCTCTAAAAGAAGCC
CTCAACTTTGGTATTGGTCTGCATCATGCTGGTTTAGTTGAATCTGATCGTCAGCTGGCAGAAGAACTCTTTGCC
AACAACAAGATCCAAGTTCTGGTCGCGACCAGTACTCTTGCATGGGGTGTTAACCTTCCAGCGCATCTTGTGGTG
GTCAAAGGCACACAGTTCTTCGACGCTAAAATCGAAGGTTATCGGGATATGGACTTGACCGACGTTCTGCAAATG
CTCGGTCGTGCCGGTCGGCCGCAGTTTGACACATCCGGTATTGCACGCATCTTCACGCAGGACTCAAAGAAGGCT
TTCTACAAGCACTTCCTCCACACCGGTTTCCCCGTTGAGTCGACACTTCACAAGGTCCTCGATAACCATCTTGGC
GCTGAGGTATCTGCTGGAACTATTGGAACGCAACAAGATGCACTGGACTACTTGACCTGGACATTCTTCTTCCGT
CGATTGCACAAGAACCCGTCATATTACGGTCTCGAGATCTCTGCAGAGGAACAAAACACCATGGCAGCTCAGGCC
ACAGCTCAAGATTTCATGGTTGAATTGGTCGCAAAGTCGCTCAATGATCTCGCAGAATCGTCCTGTGTTCTCGTG
GACTCGGTCACCGGAGAGGTCGATTCCACTCCCTTCGGCAAGATCATGAGTTACTACTACCTGTCACATAAGACG
ATCCGGTACCTCGTGTCCCATGCCAAGCGTGATCCGACTTTCCAGGATGTCTTGAGCTGGATGTGCTCTGCCACC
GAATTCGACGAGCTGCCTGTCAGACACAATGAAGATCTGATCAACGCTGAGTTGGCCGAGAACTTGCCGCTTTCT
ATTGACTGCATGGGCGACGCGCCCCTATGGGACCCACACACCAAGGCCTTCCTCCTCCTGCAGGCCTACATGTCA
CGGATCGATCTTCCCATCACTGATTATGTTGGCGATCAGACATCTGTGCTCGATCAAGGTATTCGTGTCATCCAG
GCCTCAATCGATGTCATGGCTGAGCTCGGGTATCTTCCTGCGTGTCAGATGCTCATGACCCTCCTACAATGCATC
AAGTCGGCGCGCTGGCCTGAAGACCACCCATTGTCGATTCTGCCAGGCATTCCGACCGAGAAGCCACCTAGTGGT
CTCCCGGGAACTCTTGTATCGCTCTCGTCACAGCCTGTTGGTGCAGTCGCCGCTCTGGTGAAGAAATTAAATCTT
CCATTTAACTTCACTCGCATTACGTCCCAGCTGCCTCATCTGTCGGTCGCCATTGCAAATGTTTCTGCTAAGGGC
GTGGCTGTGTCTTTGACACGGCGTAACCAGCCCACAACCCCAGAATGCAAGGTCTACGCTCCTCGATTCCCCAAA
CCACAAACTGAGGGCTTCTTCTTGATTGTCTGCAGTGCTCTTCCCAATGGGATGGATGGTGAATTACTTGGCCTG
AAGCGTGTTTCTTGGCCACCAGTGTCTAAGCGCAATGGAAACGGCAAGGACAAGGGCAACCATGGTGCTAGTTCC
AGTCGCGCAGGAGCTGCCAAAGATAACAAGGTTGACGTGTTGACCGTTCGCTCAAATATTAAATTCCCCGAAGGC
ATCCTCGCGGATTCCACGAGTACGAGCACAGCTCGGGTGAATATCAGAGTCATCAGTGACTCGTACGTTGGGATG
GCATGGACTCTTTCCAATATCGAAGTTAATTTGGATACTGGCATCGATACGCAGACTGTGGCGGAGGCCAGCGTT
CCAACGAAGGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail