Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2407.t1
Gene name
Locationscaffold_02:2467185..2470878
Strand+
Gene length (bp)3693
Transcript length (bp)3693
Coding sequence length (bp)3693
Protein length (aa) 1231

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04408 HA2 Helicase associated domain (HA2) 7.4E-24 958 1046
PF07717 OB_NTP_bind Oligonucleotide/oligosaccharide-binding (OB)-fold 2.8E-20 1104 1179
PF00271 Helicase_C Helicase conserved C-terminal domain 3.9E-13 766 896
PF00575 S1 S1 RNA binding domain 1.5E-10 263 331

GO

GO Term Description Terminal node
GO:0004386 helicase activity Yes
GO:0003676 nucleic acid binding Yes
GO:0097159 organic cyclic compound binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:0016462 pyrophosphatase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2407.t1
MDDLESLELFSLVSRVTNEFENHLGIADKTLAEFVIDQHLKCNGKFSEFKKFFDDMGGEFPQSLLESVDRMVLTM
HPKYKGKKAENGKGASDAKDDMDLLDALEQKSRVFKGLAVPDTEKRWEEEDYTDPQGADEADAQAGAMDDTFAML
EGLAGKAKEDKPHAPRNDRGTRKRSRSPENNDYDRGRRRDKYRSRSRSRSAPGYNKNDDLVDEFGRSIRKYGRED
SRRNGHSDHRRHRGRDEDNDFRRPPPLELDDHPVLFKVYDGTVTGVKDFGAFVNLKGVRGKVDGLVHVSAMQEGA
RVNHPSDLVSRGQPVKVKVASIEGTRIGLSMKEVDQVTGMDLVPQKRLASGANMERLDGGFIDDKYGSLGSDVPV
IEGSGGRPMRNRKRMTSPERWEIRQLIASGVASAADYPDIDEEYNATLTGEGTFEEEEDIDIEVKDEEPPFLAGQ
TKQSLELSPIRVVKAPDGSMNRSAMAGTNLAKERRELKQQEAQDKAAEKAADVDLNAQWQDPMVAPEERKFAADL
RSAQQPKQDEAVPEWKRVTMGKNASFGKRTTMSMKQQRESLPVYKFRKQLLDAVKDNQMMIVVGDTGSGKTTQLT
QYLAEGGYGNTGMIGCTQPRRVAAMSVAKRVAEEVGCKLGAEVGYTIRFEDCTSPDTKIKYMTDGMLQREILLDP
DLKRYSVIMLDEAHERTIATDILFGLLKKTVKRRPDLRLIITSATLDAEKFSEYFHGCPIFSIPGRTFPVEVMYS
KEPESDYLDAALITVMQIHLTEPQGDILLFLTGQEEIDTACEILFERMKALGPTVPELVVLPVYSALPSEMQSRI
FDPAPPGGRKVVIATNIAETSITIDQIYYVIDPGFVKQNAYDPKLGMDSLVVTPISQAQAKQRAGRAGRTGPGKC
FRLYTEAAYQSEMLPTTIPEIQRQNLSHTILMLKAMGINDLLHFDFMDPPPTNTMLTALEELYALSALDDEGLLT
RLGRKMADFPMEPALAKVLIASVDSGCSDEMLSIVAMLSIQSVFYRPKEKQQQADQKKSKFHDPHGDHLTLLNVY
NGWKNAGFNNSWCFENFIQARQIKRAQDVRQQLLGIMNRYKHRIVSCGRDTMKVRQSLCTGFFRNAARKDPQEGY
KTLVEGTPVYMHPSSAMFGKPAEHVIYHTLVLTTKEYMHCTTAIEPKWLVEAAPTFFKVAPTDRLSKRKKAERIQ
PLHNRFAGEDDWRISAQRRQGRGGGGGTWG*
Coding >Pro_DTO377G3_2|g2407.t1
ATGGATGACCTCGAGTCTCTGGAGCTGTTCTCGCTCGTCTCGCGCGTGACGAACGAGTTCGAGAACCATCTGGGA
ATCGCCGACAAGACTCTCGCAGAGTTCGTGATCGATCAGCACCTCAAATGCAATGGCAAGTTTTCTGAATTCAAG
AAATTTTTCGACGACATGGGCGGCGAATTCCCGCAGAGTCTCCTGGAAAGTGTCGACCGCATGGTGCTCACGATG
CACCCCAAATACAAAGGAAAGAAAGCGGAGAACGGCAAAGGAGCTTCGGATGCCAAAGACGATATGGATTTGCTT
GATGCTCTGGAGCAAAAATCTCGCGTGTTCAAGGGCCTTGCGGTCCCCGATACGGAGAAGCGCTGGGAGGAAGAA
GACTACACAGATCCTCAAGGCGCAGACGAGGCCGATGCACAGGCAGGCGCGATGGACGACACTTTTGCCATGCTC
GAGGGACTGGCAGGAAAAGCGAAGGAGGACAAACCGCATGCGCCGAGAAACGATCGCGGAACTAGGAAGCGGAGC
CGCAGCCCCGAGAACAACGATTACGACCGTGGACGGCGCAGAGACAAATACCGCTCGCGATCAAGGTCTCGAAGC
GCCCCGGGGTATAACAAAAACGATGATCTTGTGGACGAGTTCGGGAGATCGATTAGGAAATATGGCCGGGAAGAC
AGCCGTCGCAATGGCCATAGTGACCATCGGAGACACCGTGGTCGCGACGAGGATAATGATTTCCGTCGTCCTCCG
CCTCTCGAGCTGGATGACCATCCCGTTCTTTTCAAGGTCTATGATGGAACCGTGACAGGTGTAAAAGATTTCGGT
GCTTTTGTGAATCTAAAGGGCGTCAGGGGGAAGGTGGATGGTCTTGTTCATGTTTCAGCAATGCAAGAAGGAGCA
CGAGTGAATCATCCTTCGGATTTGGTCTCGCGCGGACAACCAGTCAAAGTCAAAGTGGCTAGTATCGAAGGCACT
CGCATCGGACTGTCCATGAAGGAGGTGGATCAAGTGACAGGCATGGATCTTGTTCCCCAGAAGCGCCTTGCTTCT
GGTGCAAATATGGAACGCCTCGATGGTGGATTCATAGATGACAAGTACGGCAGCCTCGGATCCGATGTGCCCGTT
ATTGAAGGGTCTGGAGGTCGACCAATGAGGAACCGAAAGCGCATGACTTCGCCAGAGCGATGGGAGATTAGACAA
TTGATTGCCTCCGGGGTTGCCTCTGCAGCAGATTATCCCGACATCGACGAGGAATATAATGCAACGCTCACCGGC
GAAGGCACTTTCGAAGAGGAGGAAGATATCGACATTGAGGTCAAAGATGAGGAGCCTCCTTTCTTGGCTGGCCAG
ACGAAGCAATCCCTCGAACTTTCTCCTATTCGTGTTGTCAAGGCCCCCGATGGCTCAATGAATCGTTCTGCCATG
GCAGGCACTAACCTTGCCAAGGAGAGACGCGAACTAAAGCAGCAGGAAGCTCAAGACAAGGCGGCTGAGAAGGCG
GCAGATGTTGATCTCAATGCTCAATGGCAGGACCCCATGGTTGCACCGGAAGAGCGAAAGTTTGCTGCTGATCTT
CGGAGTGCCCAGCAACCCAAGCAGGACGAGGCTGTACCGGAGTGGAAGAGAGTGACGATGGGCAAAAACGCATCG
TTTGGAAAGCGGACAACCATGTCCATGAAACAACAACGCGAGAGTCTTCCAGTCTACAAGTTCCGAAAGCAATTG
CTGGATGCAGTGAAGGACAATCAAATGATGATTGTCGTCGGAGATACAGGTTCTGGAAAAACCACGCAATTGACA
CAGTACCTGGCCGAGGGCGGATATGGAAACACCGGAATGATTGGTTGCACCCAGCCTCGCCGTGTTGCTGCCATG
TCAGTTGCTAAACGTGTAGCTGAGGAAGTTGGTTGCAAGCTCGGAGCAGAAGTTGGATATACCATCCGTTTCGAG
GATTGTACTAGCCCAGACACCAAGATCAAATACATGACCGACGGAATGCTTCAGAGAGAAATTCTTTTGGATCCA
GACCTCAAGAGATATTCCGTTATCATGCTCGACGAAGCGCACGAGCGGACAATCGCGACTGATATCCTGTTCGGA
CTGTTGAAAAAGACAGTCAAACGAAGACCAGATCTCAGATTGATTATCACCTCTGCCACACTGGACGCTGAAAAG
TTCTCCGAATACTTCCACGGCTGTCCCATTTTCTCCATTCCCGGTCGAACTTTCCCTGTCGAAGTCATGTACTCC
AAGGAGCCCGAATCTGATTATCTAGATGCCGCACTCATCACTGTCATGCAAATTCACTTGACAGAACCGCAAGGT
GACATTCTGCTCTTCTTAACGGGCCAAGAAGAGATTGATACAGCATGTGAGATCTTATTCGAGCGCATGAAAGCT
TTGGGACCTACTGTCCCTGAACTGGTTGTCTTACCTGTTTACTCTGCACTACCCAGTGAGATGCAGAGTAGGATT
TTCGACCCGGCACCTCCAGGCGGACGTAAAGTTGTTATTGCAACCAATATTGCTGAGACCTCGATCACAATTGAT
CAGATTTACTACGTCATTGATCCCGGTTTTGTGAAGCAGAATGCCTACGATCCGAAGCTCGGCATGGATTCTCTT
GTGGTGACTCCAATTTCTCAAGCGCAAGCTAAGCAAAGAGCTGGCCGTGCCGGAAGAACGGGACCTGGAAAGTGC
TTCCGATTGTATACAGAGGCTGCCTATCAGTCTGAAATGCTTCCAACAACCATTCCCGAAATTCAGCGTCAGAAC
CTCTCTCACACCATTCTCATGCTCAAGGCCATGGGTATCAACGACCTCCTCCACTTCGATTTCATGGACCCACCG
CCTACCAACACAATGTTGACAGCACTCGAAGAATTATATGCCTTGTCAGCACTTGATGATGAGGGTCTTTTGACT
CGACTTGGACGAAAGATGGCCGATTTCCCAATGGAACCTGCGCTTGCGAAGGTGCTCATTGCATCCGTGGATTCA
GGCTGCTCCGATGAAATGCTTAGCATTGTTGCCATGCTATCAATCCAGTCTGTCTTCTACCGCCCCAAAGAAAAG
CAGCAACAAGCAGACCAGAAAAAGTCCAAATTCCACGATCCCCACGGCGATCATCTGACCCTCCTCAATGTCTAC
AATGGGTGGAAGAACGCAGGCTTCAACAACTCCTGGTGTTTCGAGAACTTCATCCAAGCACGACAGATCAAGCGC
GCCCAAGATGTGCGCCAGCAACTACTAGGCATCATGAACCGTTACAAGCACCGGATCGTCTCTTGTGGCCGAGAT
ACCATGAAAGTGCGGCAGTCTCTATGTACCGGCTTCTTCCGCAACGCAGCACGGAAAGACCCCCAGGAAGGATAC
AAGACCCTGGTGGAAGGAACGCCCGTGTACATGCACCCTAGTTCCGCGATGTTCGGCAAACCGGCCGAGCATGTC
ATCTACCACACCCTGGTCCTCACAACCAAGGAATACATGCACTGCACCACTGCTATTGAGCCGAAATGGCTCGTG
GAAGCGGCGCCTACTTTCTTCAAGGTTGCACCTACGGATCGATTGTCAAAACGTAAGAAGGCAGAGCGCATCCAG
CCTCTGCACAACCGCTTTGCTGGCGAAGACGATTGGCGTATCTCTGCCCAGCGACGCCAAGGCAGAGGTGGTGGT
GGTGGAACTTGGGGTTGA
Transcript >Pro_DTO377G3_2|g2407.t1
ATGGATGACCTCGAGTCTCTGGAGCTGTTCTCGCTCGTCTCGCGCGTGACGAACGAGTTCGAGAACCATCTGGGA
ATCGCCGACAAGACTCTCGCAGAGTTCGTGATCGATCAGCACCTCAAATGCAATGGCAAGTTTTCTGAATTCAAG
AAATTTTTCGACGACATGGGCGGCGAATTCCCGCAGAGTCTCCTGGAAAGTGTCGACCGCATGGTGCTCACGATG
CACCCCAAATACAAAGGAAAGAAAGCGGAGAACGGCAAAGGAGCTTCGGATGCCAAAGACGATATGGATTTGCTT
GATGCTCTGGAGCAAAAATCTCGCGTGTTCAAGGGCCTTGCGGTCCCCGATACGGAGAAGCGCTGGGAGGAAGAA
GACTACACAGATCCTCAAGGCGCAGACGAGGCCGATGCACAGGCAGGCGCGATGGACGACACTTTTGCCATGCTC
GAGGGACTGGCAGGAAAAGCGAAGGAGGACAAACCGCATGCGCCGAGAAACGATCGCGGAACTAGGAAGCGGAGC
CGCAGCCCCGAGAACAACGATTACGACCGTGGACGGCGCAGAGACAAATACCGCTCGCGATCAAGGTCTCGAAGC
GCCCCGGGGTATAACAAAAACGATGATCTTGTGGACGAGTTCGGGAGATCGATTAGGAAATATGGCCGGGAAGAC
AGCCGTCGCAATGGCCATAGTGACCATCGGAGACACCGTGGTCGCGACGAGGATAATGATTTCCGTCGTCCTCCG
CCTCTCGAGCTGGATGACCATCCCGTTCTTTTCAAGGTCTATGATGGAACCGTGACAGGTGTAAAAGATTTCGGT
GCTTTTGTGAATCTAAAGGGCGTCAGGGGGAAGGTGGATGGTCTTGTTCATGTTTCAGCAATGCAAGAAGGAGCA
CGAGTGAATCATCCTTCGGATTTGGTCTCGCGCGGACAACCAGTCAAAGTCAAAGTGGCTAGTATCGAAGGCACT
CGCATCGGACTGTCCATGAAGGAGGTGGATCAAGTGACAGGCATGGATCTTGTTCCCCAGAAGCGCCTTGCTTCT
GGTGCAAATATGGAACGCCTCGATGGTGGATTCATAGATGACAAGTACGGCAGCCTCGGATCCGATGTGCCCGTT
ATTGAAGGGTCTGGAGGTCGACCAATGAGGAACCGAAAGCGCATGACTTCGCCAGAGCGATGGGAGATTAGACAA
TTGATTGCCTCCGGGGTTGCCTCTGCAGCAGATTATCCCGACATCGACGAGGAATATAATGCAACGCTCACCGGC
GAAGGCACTTTCGAAGAGGAGGAAGATATCGACATTGAGGTCAAAGATGAGGAGCCTCCTTTCTTGGCTGGCCAG
ACGAAGCAATCCCTCGAACTTTCTCCTATTCGTGTTGTCAAGGCCCCCGATGGCTCAATGAATCGTTCTGCCATG
GCAGGCACTAACCTTGCCAAGGAGAGACGCGAACTAAAGCAGCAGGAAGCTCAAGACAAGGCGGCTGAGAAGGCG
GCAGATGTTGATCTCAATGCTCAATGGCAGGACCCCATGGTTGCACCGGAAGAGCGAAAGTTTGCTGCTGATCTT
CGGAGTGCCCAGCAACCCAAGCAGGACGAGGCTGTACCGGAGTGGAAGAGAGTGACGATGGGCAAAAACGCATCG
TTTGGAAAGCGGACAACCATGTCCATGAAACAACAACGCGAGAGTCTTCCAGTCTACAAGTTCCGAAAGCAATTG
CTGGATGCAGTGAAGGACAATCAAATGATGATTGTCGTCGGAGATACAGGTTCTGGAAAAACCACGCAATTGACA
CAGTACCTGGCCGAGGGCGGATATGGAAACACCGGAATGATTGGTTGCACCCAGCCTCGCCGTGTTGCTGCCATG
TCAGTTGCTAAACGTGTAGCTGAGGAAGTTGGTTGCAAGCTCGGAGCAGAAGTTGGATATACCATCCGTTTCGAG
GATTGTACTAGCCCAGACACCAAGATCAAATACATGACCGACGGAATGCTTCAGAGAGAAATTCTTTTGGATCCA
GACCTCAAGAGATATTCCGTTATCATGCTCGACGAAGCGCACGAGCGGACAATCGCGACTGATATCCTGTTCGGA
CTGTTGAAAAAGACAGTCAAACGAAGACCAGATCTCAGATTGATTATCACCTCTGCCACACTGGACGCTGAAAAG
TTCTCCGAATACTTCCACGGCTGTCCCATTTTCTCCATTCCCGGTCGAACTTTCCCTGTCGAAGTCATGTACTCC
AAGGAGCCCGAATCTGATTATCTAGATGCCGCACTCATCACTGTCATGCAAATTCACTTGACAGAACCGCAAGGT
GACATTCTGCTCTTCTTAACGGGCCAAGAAGAGATTGATACAGCATGTGAGATCTTATTCGAGCGCATGAAAGCT
TTGGGACCTACTGTCCCTGAACTGGTTGTCTTACCTGTTTACTCTGCACTACCCAGTGAGATGCAGAGTAGGATT
TTCGACCCGGCACCTCCAGGCGGACGTAAAGTTGTTATTGCAACCAATATTGCTGAGACCTCGATCACAATTGAT
CAGATTTACTACGTCATTGATCCCGGTTTTGTGAAGCAGAATGCCTACGATCCGAAGCTCGGCATGGATTCTCTT
GTGGTGACTCCAATTTCTCAAGCGCAAGCTAAGCAAAGAGCTGGCCGTGCCGGAAGAACGGGACCTGGAAAGTGC
TTCCGATTGTATACAGAGGCTGCCTATCAGTCTGAAATGCTTCCAACAACCATTCCCGAAATTCAGCGTCAGAAC
CTCTCTCACACCATTCTCATGCTCAAGGCCATGGGTATCAACGACCTCCTCCACTTCGATTTCATGGACCCACCG
CCTACCAACACAATGTTGACAGCACTCGAAGAATTATATGCCTTGTCAGCACTTGATGATGAGGGTCTTTTGACT
CGACTTGGACGAAAGATGGCCGATTTCCCAATGGAACCTGCGCTTGCGAAGGTGCTCATTGCATCCGTGGATTCA
GGCTGCTCCGATGAAATGCTTAGCATTGTTGCCATGCTATCAATCCAGTCTGTCTTCTACCGCCCCAAAGAAAAG
CAGCAACAAGCAGACCAGAAAAAGTCCAAATTCCACGATCCCCACGGCGATCATCTGACCCTCCTCAATGTCTAC
AATGGGTGGAAGAACGCAGGCTTCAACAACTCCTGGTGTTTCGAGAACTTCATCCAAGCACGACAGATCAAGCGC
GCCCAAGATGTGCGCCAGCAACTACTAGGCATCATGAACCGTTACAAGCACCGGATCGTCTCTTGTGGCCGAGAT
ACCATGAAAGTGCGGCAGTCTCTATGTACCGGCTTCTTCCGCAACGCAGCACGGAAAGACCCCCAGGAAGGATAC
AAGACCCTGGTGGAAGGAACGCCCGTGTACATGCACCCTAGTTCCGCGATGTTCGGCAAACCGGCCGAGCATGTC
ATCTACCACACCCTGGTCCTCACAACCAAGGAATACATGCACTGCACCACTGCTATTGAGCCGAAATGGCTCGTG
GAAGCGGCGCCTACTTTCTTCAAGGTTGCACCTACGGATCGATTGTCAAAACGTAAGAAGGCAGAGCGCATCCAG
CCTCTGCACAACCGCTTTGCTGGCGAAGACGATTGGCGTATCTCTGCCCAGCGACGCCAAGGCAGAGGTGGTGGT
GGTGGAACTTGGGGTTGA
Gene >Pro_DTO377G3_2|g2407.t1
ATGGATGACCTCGAGTCTCTGGAGCTGTTCTCGCTCGTCTCGCGCGTGACGAACGAGTTCGAGAACCATCTGGGA
ATCGCCGACAAGACTCTCGCAGAGTTCGTGATCGATCAGCACCTCAAATGCAATGGCAAGTTTTCTGAATTCAAG
AAATTTTTCGACGACATGGGCGGCGAATTCCCGCAGAGTCTCCTGGAAAGTGTCGACCGCATGGTGCTCACGATG
CACCCCAAATACAAAGGAAAGAAAGCGGAGAACGGCAAAGGAGCTTCGGATGCCAAAGACGATATGGATTTGCTT
GATGCTCTGGAGCAAAAATCTCGCGTGTTCAAGGGCCTTGCGGTCCCCGATACGGAGAAGCGCTGGGAGGAAGAA
GACTACACAGATCCTCAAGGCGCAGACGAGGCCGATGCACAGGCAGGCGCGATGGACGACACTTTTGCCATGCTC
GAGGGACTGGCAGGAAAAGCGAAGGAGGACAAACCGCATGCGCCGAGAAACGATCGCGGAACTAGGAAGCGGAGC
CGCAGCCCCGAGAACAACGATTACGACCGTGGACGGCGCAGAGACAAATACCGCTCGCGATCAAGGTCTCGAAGC
GCCCCGGGGTATAACAAAAACGATGATCTTGTGGACGAGTTCGGGAGATCGATTAGGAAATATGGCCGGGAAGAC
AGCCGTCGCAATGGCCATAGTGACCATCGGAGACACCGTGGTCGCGACGAGGATAATGATTTCCGTCGTCCTCCG
CCTCTCGAGCTGGATGACCATCCCGTTCTTTTCAAGGTCTATGATGGAACCGTGACAGGTGTAAAAGATTTCGGT
GCTTTTGTGAATCTAAAGGGCGTCAGGGGGAAGGTGGATGGTCTTGTTCATGTTTCAGCAATGCAAGAAGGAGCA
CGAGTGAATCATCCTTCGGATTTGGTCTCGCGCGGACAACCAGTCAAAGTCAAAGTGGCTAGTATCGAAGGCACT
CGCATCGGACTGTCCATGAAGGAGGTGGATCAAGTGACAGGCATGGATCTTGTTCCCCAGAAGCGCCTTGCTTCT
GGTGCAAATATGGAACGCCTCGATGGTGGATTCATAGATGACAAGTACGGCAGCCTCGGATCCGATGTGCCCGTT
ATTGAAGGGTCTGGAGGTCGACCAATGAGGAACCGAAAGCGCATGACTTCGCCAGAGCGATGGGAGATTAGACAA
TTGATTGCCTCCGGGGTTGCCTCTGCAGCAGATTATCCCGACATCGACGAGGAATATAATGCAACGCTCACCGGC
GAAGGCACTTTCGAAGAGGAGGAAGATATCGACATTGAGGTCAAAGATGAGGAGCCTCCTTTCTTGGCTGGCCAG
ACGAAGCAATCCCTCGAACTTTCTCCTATTCGTGTTGTCAAGGCCCCCGATGGCTCAATGAATCGTTCTGCCATG
GCAGGCACTAACCTTGCCAAGGAGAGACGCGAACTAAAGCAGCAGGAAGCTCAAGACAAGGCGGCTGAGAAGGCG
GCAGATGTTGATCTCAATGCTCAATGGCAGGACCCCATGGTTGCACCGGAAGAGCGAAAGTTTGCTGCTGATCTT
CGGAGTGCCCAGCAACCCAAGCAGGACGAGGCTGTACCGGAGTGGAAGAGAGTGACGATGGGCAAAAACGCATCG
TTTGGAAAGCGGACAACCATGTCCATGAAACAACAACGCGAGAGTCTTCCAGTCTACAAGTTCCGAAAGCAATTG
CTGGATGCAGTGAAGGACAATCAAATGATGATTGTCGTCGGAGATACAGGTTCTGGAAAAACCACGCAATTGACA
CAGTACCTGGCCGAGGGCGGATATGGAAACACCGGAATGATTGGTTGCACCCAGCCTCGCCGTGTTGCTGCCATG
TCAGTTGCTAAACGTGTAGCTGAGGAAGTTGGTTGCAAGCTCGGAGCAGAAGTTGGATATACCATCCGTTTCGAG
GATTGTACTAGCCCAGACACCAAGATCAAATACATGACCGACGGAATGCTTCAGAGAGAAATTCTTTTGGATCCA
GACCTCAAGAGATATTCCGTTATCATGCTCGACGAAGCGCACGAGCGGACAATCGCGACTGATATCCTGTTCGGA
CTGTTGAAAAAGACAGTCAAACGAAGACCAGATCTCAGATTGATTATCACCTCTGCCACACTGGACGCTGAAAAG
TTCTCCGAATACTTCCACGGCTGTCCCATTTTCTCCATTCCCGGTCGAACTTTCCCTGTCGAAGTCATGTACTCC
AAGGAGCCCGAATCTGATTATCTAGATGCCGCACTCATCACTGTCATGCAAATTCACTTGACAGAACCGCAAGGT
GACATTCTGCTCTTCTTAACGGGCCAAGAAGAGATTGATACAGCATGTGAGATCTTATTCGAGCGCATGAAAGCT
TTGGGACCTACTGTCCCTGAACTGGTTGTCTTACCTGTTTACTCTGCACTACCCAGTGAGATGCAGAGTAGGATT
TTCGACCCGGCACCTCCAGGCGGACGTAAAGTTGTTATTGCAACCAATATTGCTGAGACCTCGATCACAATTGAT
CAGATTTACTACGTCATTGATCCCGGTTTTGTGAAGCAGAATGCCTACGATCCGAAGCTCGGCATGGATTCTCTT
GTGGTGACTCCAATTTCTCAAGCGCAAGCTAAGCAAAGAGCTGGCCGTGCCGGAAGAACGGGACCTGGAAAGTGC
TTCCGATTGTATACAGAGGCTGCCTATCAGTCTGAAATGCTTCCAACAACCATTCCCGAAATTCAGCGTCAGAAC
CTCTCTCACACCATTCTCATGCTCAAGGCCATGGGTATCAACGACCTCCTCCACTTCGATTTCATGGACCCACCG
CCTACCAACACAATGTTGACAGCACTCGAAGAATTATATGCCTTGTCAGCACTTGATGATGAGGGTCTTTTGACT
CGACTTGGACGAAAGATGGCCGATTTCCCAATGGAACCTGCGCTTGCGAAGGTGCTCATTGCATCCGTGGATTCA
GGCTGCTCCGATGAAATGCTTAGCATTGTTGCCATGCTATCAATCCAGTCTGTCTTCTACCGCCCCAAAGAAAAG
CAGCAACAAGCAGACCAGAAAAAGTCCAAATTCCACGATCCCCACGGCGATCATCTGACCCTCCTCAATGTCTAC
AATGGGTGGAAGAACGCAGGCTTCAACAACTCCTGGTGTTTCGAGAACTTCATCCAAGCACGACAGATCAAGCGC
GCCCAAGATGTGCGCCAGCAACTACTAGGCATCATGAACCGTTACAAGCACCGGATCGTCTCTTGTGGCCGAGAT
ACCATGAAAGTGCGGCAGTCTCTATGTACCGGCTTCTTCCGCAACGCAGCACGGAAAGACCCCCAGGAAGGATAC
AAGACCCTGGTGGAAGGAACGCCCGTGTACATGCACCCTAGTTCCGCGATGTTCGGCAAACCGGCCGAGCATGTC
ATCTACCACACCCTGGTCCTCACAACCAAGGAATACATGCACTGCACCACTGCTATTGAGCCGAAATGGCTCGTG
GAAGCGGCGCCTACTTTCTTCAAGGTTGCACCTACGGATCGATTGTCAAAACGTAAGAAGGCAGAGCGCATCCAG
CCTCTGCACAACCGCTTTGCTGGCGAAGACGATTGGCGTATCTCTGCCCAGCGACGCCAAGGCAGAGGTGGTGGT
GGTGGAACTTGGGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail