Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2406.t1
Gene name
Locationscaffold_02:2464338..2466758
Strand+
Gene length (bp)2420
Transcript length (bp)2367
Coding sequence length (bp)2367
Protein length (aa) 789

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12513 SUV3_C Mitochondrial degradasome RNA helicase subunit C terminal 3.6E-17 621 667
PF00271 Helicase_C Helicase conserved C-terminal domain 2.3E-10 349 457

GO

GO Term Description Terminal node
GO:0016817 hydrolase activity, acting on acid anhydrides Yes
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2406.t1
MQPWTSGSRSLYALRPLTRFAVRPFTTTSILQRSKKVKTSPDRKADTKKGKTLVGNPAGRSIRQDIAAARDFNEL
VEATLRDVYSKLNKSGESLEGWTQFERQIKNACKSDDKKASAQWGPLRHIKVALQKAYLASGLQGLREEVEYMQY
SENITARFSAPILEAQQEVADLRWPAEWYPRARSMQRTIHLHVGPTNSGKTYHALQRLAKSKNGFYAGPLRLLAQ
EVYHRFKADGVPCSLVTGDDVKFPEDDQVPRITSNTVEMVSLGQEYDVGVIDEIQMIANSSRGWAWTRAFLGAQA
TELHLCGETRAIPLIRELCALTGDTLEVHRYERLNALEVMPHSLKGNLNSLEKGDCVVVFSRKGIHAMKADIEKT
TGRRAAIVYGGLPAEIRTQQANLFNDPDNDYDFLVASDAIGMGLNLSCKRVIFDTLVKRVPTGLQRLTVPEIKQI
GGRAGRYRPANATESTSEEPNVGLISCLEEVDLPYIQQALKLEPPPLSAAGIFPPESVFRKFAAYFPPGVPFEYL
IKRVLDIAKVNPLFFLCDPSSQLENAEIIDTVKGLPFEDQLKFMVSPMDRKSSGSRDVTGAMADCVAEHHEGRLL
DIAHLNLEVIEQPVSGSNDYLHDLESLHRAVILYLWLSFRFGGVFTDRTLASHVKELVEERMVRALTEFSANKRL
RKGASLKRQIALQKQLLEQERMGVAGDWMKPSGEGEQIEINLPEEGASEAAEAAEVAEGESSDAELSLFESSPEA
EGEEEGKEEGKEESSSPDFDDSEPELTESYYDTEVPKE*
Coding >Pro_DTO377G3_2|g2406.t1
ATGCAGCCATGGACTAGCGGTAGTCGTTCCCTCTATGCTTTGCGGCCCTTGACTCGTTTTGCTGTACGGCCCTTC
ACCACAACCTCGATTCTGCAGCGCTCGAAAAAGGTCAAAACATCGCCGGACAGGAAAGCGGACACAAAAAAGGGC
AAAACACTTGTGGGGAATCCCGCCGGGAGATCCATCCGACAGGATATTGCGGCCGCACGAGATTTCAACGAACTC
GTGGAAGCAACCCTACGCGATGTATACAGCAAGTTGAACAAATCAGGCGAATCGCTAGAAGGATGGACCCAATTT
GAGCGCCAAATCAAAAACGCCTGCAAATCAGATGATAAGAAAGCCTCTGCACAATGGGGACCCCTTCGGCATATC
AAGGTAGCGCTGCAAAAAGCCTACCTGGCATCCGGACTTCAGGGTCTGCGGGAGGAGGTGGAATACATGCAGTAT
TCGGAAAACATCACTGCCAGGTTTTCGGCACCCATCCTGGAAGCACAGCAAGAAGTGGCCGACCTTCGGTGGCCA
GCCGAGTGGTATCCGCGCGCACGATCGATGCAGCGAACAATCCATCTCCATGTCGGGCCGACGAATTCCGGAAAG
ACCTACCATGCGCTGCAACGACTGGCGAAAAGCAAGAACGGGTTTTACGCAGGTCCGCTGAGATTGCTCGCACAA
GAAGTATATCATCGATTCAAGGCAGATGGGGTTCCATGCAGTTTAGTCACTGGTGACGACGTCAAATTTCCCGAG
GATGATCAAGTACCGCGTATTACCAGTAATACTGTGGAAATGGTCAGCCTGGGGCAGGAATACGATGTTGGCGTG
ATCGATGAAATCCAAATGATTGCGAACTCATCAAGAGGATGGGCATGGACTCGAGCCTTCCTTGGTGCTCAGGCC
ACCGAACTGCACCTGTGCGGCGAAACCCGCGCTATACCATTGATTCGGGAGCTATGTGCACTCACGGGAGATACT
TTGGAGGTCCACCGCTACGAACGCCTGAACGCCCTGGAAGTGATGCCACATAGTCTAAAGGGTAATCTCAATAGC
CTTGAAAAAGGCGACTGTGTAGTCGTATTTTCTCGGAAAGGTATACACGCTATGAAGGCAGACATTGAAAAGACC
ACCGGAAGACGCGCAGCCATCGTTTATGGTGGTCTGCCGGCGGAGATTCGGACCCAACAGGCCAATCTGTTCAAC
GACCCAGACAATGACTATGACTTCCTCGTAGCAAGTGACGCGATTGGCATGGGTCTTAATCTGAGCTGCAAGCGT
GTTATCTTTGACACTCTCGTCAAGCGTGTCCCGACTGGACTTCAACGGCTTACTGTTCCTGAGATCAAACAAATT
GGCGGGCGTGCTGGTCGATATCGTCCAGCCAATGCCACGGAAAGCACAAGTGAGGAGCCTAACGTGGGCCTGATC
TCCTGTCTCGAAGAGGTTGACCTTCCATATATCCAACAGGCTTTGAAGTTGGAGCCCCCACCGCTGAGTGCGGCG
GGCATCTTCCCTCCAGAATCTGTTTTCCGGAAATTCGCCGCCTATTTCCCACCAGGTGTACCTTTCGAATATCTG
ATCAAGCGGGTCCTGGACATTGCCAAGGTCAACCCTTTGTTCTTCTTGTGTGACCCTAGCAGTCAGTTGGAGAAC
GCCGAGATTATCGACACTGTCAAAGGACTGCCGTTTGAGGACCAGTTAAAGTTCATGGTTTCTCCAATGGACCGT
AAAAGTTCAGGCTCGCGTGATGTTACTGGTGCTATGGCGGACTGCGTAGCCGAACACCATGAAGGACGACTTCTA
GATATCGCCCATCTCAACCTGGAAGTTATCGAGCAGCCCGTTTCTGGCAGCAACGACTATTTGCATGATCTAGAA
AGCCTTCATAGGGCAGTTATCTTGTACCTGTGGCTCAGTTTCCGATTCGGTGGTGTCTTCACTGACCGAACTCTG
GCAAGTCATGTCAAGGAACTTGTTGAAGAGCGCATGGTTCGGGCATTGACCGAGTTCTCTGCCAACAAGAGGCTG
CGGAAGGGTGCTTCTCTGAAGCGCCAGATTGCGCTGCAGAAACAGTTGTTGGAGCAGGAACGTATGGGAGTTGCT
GGAGACTGGATGAAGCCCTCTGGTGAGGGAGAGCAGATTGAAATCAATCTGCCCGAAGAAGGTGCTTCAGAGGCT
GCGGAGGCTGCGGAGGTTGCGGAGGGTGAATCCTCTGACGCCGAACTCTCATTATTTGAATCGTCACCGGAGGCA
GAGGGCGAGGAAGAGGGCAAGGAAGAGGGCAAGGAAGAGAGCTCATCACCCGACTTTGACGACTCGGAGCCTGAA
CTAACAGAGTCATACTATGACACAGAAGTCCCCAAAGAGTGA
Transcript >Pro_DTO377G3_2|g2406.t1
ATGCAGCCATGGACTAGCGGTAGTCGTTCCCTCTATGCTTTGCGGCCCTTGACTCGTTTTGCTGTACGGCCCTTC
ACCACAACCTCGATTCTGCAGCGCTCGAAAAAGGTCAAAACATCGCCGGACAGGAAAGCGGACACAAAAAAGGGC
AAAACACTTGTGGGGAATCCCGCCGGGAGATCCATCCGACAGGATATTGCGGCCGCACGAGATTTCAACGAACTC
GTGGAAGCAACCCTACGCGATGTATACAGCAAGTTGAACAAATCAGGCGAATCGCTAGAAGGATGGACCCAATTT
GAGCGCCAAATCAAAAACGCCTGCAAATCAGATGATAAGAAAGCCTCTGCACAATGGGGACCCCTTCGGCATATC
AAGGTAGCGCTGCAAAAAGCCTACCTGGCATCCGGACTTCAGGGTCTGCGGGAGGAGGTGGAATACATGCAGTAT
TCGGAAAACATCACTGCCAGGTTTTCGGCACCCATCCTGGAAGCACAGCAAGAAGTGGCCGACCTTCGGTGGCCA
GCCGAGTGGTATCCGCGCGCACGATCGATGCAGCGAACAATCCATCTCCATGTCGGGCCGACGAATTCCGGAAAG
ACCTACCATGCGCTGCAACGACTGGCGAAAAGCAAGAACGGGTTTTACGCAGGTCCGCTGAGATTGCTCGCACAA
GAAGTATATCATCGATTCAAGGCAGATGGGGTTCCATGCAGTTTAGTCACTGGTGACGACGTCAAATTTCCCGAG
GATGATCAAGTACCGCGTATTACCAGTAATACTGTGGAAATGGTCAGCCTGGGGCAGGAATACGATGTTGGCGTG
ATCGATGAAATCCAAATGATTGCGAACTCATCAAGAGGATGGGCATGGACTCGAGCCTTCCTTGGTGCTCAGGCC
ACCGAACTGCACCTGTGCGGCGAAACCCGCGCTATACCATTGATTCGGGAGCTATGTGCACTCACGGGAGATACT
TTGGAGGTCCACCGCTACGAACGCCTGAACGCCCTGGAAGTGATGCCACATAGTCTAAAGGGTAATCTCAATAGC
CTTGAAAAAGGCGACTGTGTAGTCGTATTTTCTCGGAAAGGTATACACGCTATGAAGGCAGACATTGAAAAGACC
ACCGGAAGACGCGCAGCCATCGTTTATGGTGGTCTGCCGGCGGAGATTCGGACCCAACAGGCCAATCTGTTCAAC
GACCCAGACAATGACTATGACTTCCTCGTAGCAAGTGACGCGATTGGCATGGGTCTTAATCTGAGCTGCAAGCGT
GTTATCTTTGACACTCTCGTCAAGCGTGTCCCGACTGGACTTCAACGGCTTACTGTTCCTGAGATCAAACAAATT
GGCGGGCGTGCTGGTCGATATCGTCCAGCCAATGCCACGGAAAGCACAAGTGAGGAGCCTAACGTGGGCCTGATC
TCCTGTCTCGAAGAGGTTGACCTTCCATATATCCAACAGGCTTTGAAGTTGGAGCCCCCACCGCTGAGTGCGGCG
GGCATCTTCCCTCCAGAATCTGTTTTCCGGAAATTCGCCGCCTATTTCCCACCAGGTGTACCTTTCGAATATCTG
ATCAAGCGGGTCCTGGACATTGCCAAGGTCAACCCTTTGTTCTTCTTGTGTGACCCTAGCAGTCAGTTGGAGAAC
GCCGAGATTATCGACACTGTCAAAGGACTGCCGTTTGAGGACCAGTTAAAGTTCATGGTTTCTCCAATGGACCGT
AAAAGTTCAGGCTCGCGTGATGTTACTGGTGCTATGGCGGACTGCGTAGCCGAACACCATGAAGGACGACTTCTA
GATATCGCCCATCTCAACCTGGAAGTTATCGAGCAGCCCGTTTCTGGCAGCAACGACTATTTGCATGATCTAGAA
AGCCTTCATAGGGCAGTTATCTTGTACCTGTGGCTCAGTTTCCGATTCGGTGGTGTCTTCACTGACCGAACTCTG
GCAAGTCATGTCAAGGAACTTGTTGAAGAGCGCATGGTTCGGGCATTGACCGAGTTCTCTGCCAACAAGAGGCTG
CGGAAGGGTGCTTCTCTGAAGCGCCAGATTGCGCTGCAGAAACAGTTGTTGGAGCAGGAACGTATGGGAGTTGCT
GGAGACTGGATGAAGCCCTCTGGTGAGGGAGAGCAGATTGAAATCAATCTGCCCGAAGAAGGTGCTTCAGAGGCT
GCGGAGGCTGCGGAGGTTGCGGAGGGTGAATCCTCTGACGCCGAACTCTCATTATTTGAATCGTCACCGGAGGCA
GAGGGCGAGGAAGAGGGCAAGGAAGAGGGCAAGGAAGAGAGCTCATCACCCGACTTTGACGACTCGGAGCCTGAA
CTAACAGAGTCATACTATGACACAGAAGTCCCCAAAGAGTGA
Gene >Pro_DTO377G3_2|g2406.t1
ATGCAGCCATGGACTAGCGGTAGTCGTTCCCTCTATGCTTTGCGGCCCTTGACTCGTTTTGCTGTACGGCCCTTC
ACCACAACCTCGATTCTGCAGCGCTCGAAAAAGGTCAAAACATCGCCGGACAGGAAAGCGGACACAAAAAAGGGC
AAAACACTTGTGGGGAATCCCGCCGGGAGATCCATCCGACAGGATATTGCGGCCGCACGAGATTTCAACGAACTC
GTGGAAGCAACCCTACGCGATGTATACAGCAAGTTGAACAAATCAGGCGAATCGCTAGAAGGATGGACCCAATTT
GAGCGCCAAATCAAAAACGCCTGCAAATCAGATGATAAGAAAGCCTCTGCACAATGGGGACCCCTTCGGCATATC
AAGGTAGCGCTGCAAAAAGCCTACCTGGCATCCGGACTTCAGGGTCTGCGGGAGGAGGTGGAATACATGCAGTAT
TCGGAAAACATCACTGCCAGGTTTTCGGCACCCATCCTGGAAGCACAGCAAGAAGTGGCCGACCTTCGGTGGCCA
GCCGAGTGGTATCCGCGCGCACGATCGATGCAGCGAACAATCCATCTCCATGTCGGGCCGACGAATTCCGGAAAG
ACCTACCATGCGCTGCAACGACTGGCGAAAAGCAAGAACGGGTTTTACGCAGGTCCGCTGAGATTGCTCGCACAA
GAAGTATATCATCGATTCAAGGCAGATGGGGTTCCATGCAGTTTAGTCACTGGTGACGACGTCAAATTTCCCGAG
GATGATCAAGTACCGCGTATTACCAGTAATACTGTGGAAATGGTCAGCCTGGGGCAGGAATACGATGTTGGCGTG
ATCGATGAAATCCAAATGATTGCGAACTCATCAAGAGGATGGGCATGGACTCGAGCCTTCCTTGGTGCTCAGGCC
ACCGAACTGCACCTGTGCGGCGAAACCCGCGCTATACCATTGATTCGGGAGCTATGTGCACTCACGGGAGATACT
TTGGAGGTCCACCGCTACGAACGCCTGAACGCCCTGGAAGTGATGCCACATAGTCTAAAGGGTAATCTCAATAGC
CTTGAAAAAGGCGACTGTGTAGTCGTATTTTCTCGGAAAGGTATACACGCTATGAAGGCAGACATTGAAAAGACC
ACCGGAAGACGCGCAGCCATCGTTTATGGTGGTCTGCCGGCGGAGATTCGGACCCAACAGGCCAATCTGTTCAAC
GACCCAGACAATGACTATGACTTCCTCGTAGCAAGTGACGCGATTGGCATGGGTCTTAATCTGTAAGTTCTGTGC
TCCCTGGTTATATTTACGCTACCATACTAACCCACGATAGGAGCTGCAAGCGTGTTATCTTTGACACTCTCGTCA
AGCGTGTCCCGACTGGACTTCAACGGCTTACTGTTCCTGAGATCAAACAAATTGGCGGGCGTGCTGGTCGATATC
GTCCAGCCAATGCCACGGAAAGCACAAGTGAGGAGCCTAACGTGGGCCTGATCTCCTGTCTCGAAGAGGTTGACC
TTCCATATATCCAACAGGCTTTGAAGTTGGAGCCCCCACCGCTGAGTGCGGCGGGCATCTTCCCTCCAGAATCTG
TTTTCCGGAAATTCGCCGCCTATTTCCCACCAGGTGTACCTTTCGAATATCTGATCAAGCGGGTCCTGGACATTG
CCAAGGTCAACCCTTTGTTCTTCTTGTGTGACCCTAGCAGTCAGTTGGAGAACGCCGAGATTATCGACACTGTCA
AAGGACTGCCGTTTGAGGACCAGTTAAAGTTCATGGTTTCTCCAATGGACCGTAAAAGTTCAGGCTCGCGTGATG
TTACTGGTGCTATGGCGGACTGCGTAGCCGAACACCATGAAGGACGACTTCTAGATATCGCCCATCTCAACCTGG
AAGTTATCGAGCAGCCCGTTTCTGGCAGCAACGACTATTTGCATGATCTAGAAAGCCTTCATAGGGCAGTTATCT
TGTACCTGTGGCTCAGTTTCCGATTCGGTGGTGTCTTCACTGACCGAACTCTGGCAAGTCATGTCAAGGAACTTG
TTGAAGAGCGCATGGTTCGGGCATTGACCGAGTTCTCTGCCAACAAGAGGCTGCGGAAGGGTGCTTCTCTGAAGC
GCCAGATTGCGCTGCAGAAACAGTTGTTGGAGCAGGAACGTATGGGAGTTGCTGGAGACTGGATGAAGCCCTCTG
GTGAGGGAGAGCAGATTGAAATCAATCTGCCCGAAGAAGGTGCTTCAGAGGCTGCGGAGGCTGCGGAGGTTGCGG
AGGGTGAATCCTCTGACGCCGAACTCTCATTATTTGAATCGTCACCGGAGGCAGAGGGCGAGGAAGAGGGCAAGG
AAGAGGGCAAGGAAGAGAGCTCATCACCCGACTTTGACGACTCGGAGCCTGAACTAACAGAGTCATACTATGACA
CAGAAGTCCCCAAAGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail