Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2400.t1
Gene name
Locationscaffold_02:2451727..2453029
Strand+
Gene length (bp)1302
Transcript length (bp)1116
Coding sequence length (bp)1116
Protein length (aa) 372

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 1.8E-46 7 345
PF01370 Epimerase NAD dependent epimerase/dehydratase family 3.0E-46 6 283
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 5.1E-15 7 176
PF02719 Polysacc_synt_2 Polysaccharide biosynthesis protein 4.9E-10 6 128
PF04321 RmlD_sub_bind RmlD substrate binding domain 1.6E-09 6 171
PF00106 adh_short short chain dehydrogenase 5.9E-09 6 129
PF08659 KR KR domain 1.1E-05 4 135

GO

GO Term Description Terminal node
GO:0050662 coenzyme binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0006694 steroid biosynthetic process Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0003824 catalytic activity Yes
GO:0003854 3-beta-hydroxy-delta5-steroid dehydrogenase activity Yes
GO:1901360 organic cyclic compound metabolic process No
GO:0005488 binding No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0008610 lipid biosynthetic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0048037 cofactor binding No
GO:0016229 steroid dehydrogenase activity No
GO:0009058 biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No
GO:0006629 lipid metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044238 primary metabolic process No
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0008202 steroid metabolic process No
GO:0016491 oxidoreductase activity No
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2400.t1
MSAGSVLVAGGTGYIGSFTTLALLEAGYKVVVADNLYNSSVEALHRIELICGKKAEFIKLDVTVENSFDQVFEAH
PDIDSVIHFAALKAVGESGEKPLDYWLVNVYGTINLLRSMVKHNVTNIVFSSSATVYGDATRFPNMIPIPEDCPL
GPTNPYGNTKFAVETAITDAINAQRNNATKAGNEAEAKKWNGALLRYFNPAGAHPSGIMGEDPQGVPYNLLPLLA
QVATGKREKLMVFGDDYASHDGTAIRDYIHILDLADGHLKALKYLRANNPGVRAWNLGTGKGSTVYEMIRAFSTA
VGKDQPYEVAPRRAGDVLNLTANPTRAHTELGWKAERTLEQACEDLWLWTKNNPEGYRQEPPAELLAQLKK*
Coding >Pro_DTO377G3_2|g2400.t1
ATGTCTGCTGGTTCTGTTCTTGTTGCTGGTGGCACGGGCTACATTGGCTCGTTCACCACCCTGGCCCTCCTTGAG
GCTGGCTACAAGGTCGTCGTTGCCGACAACCTGTACAACTCTTCAGTCGAGGCCCTCCACCGTATTGAGCTGATC
TGCGGCAAGAAGGCCGAGTTCATCAAGCTCGATGTCACCGTGGAGAACAGCTTCGACCAAGTGTTCGAAGCTCAC
CCCGACATTGACAGCGTTATCCACTTCGCTGCCCTGAAGGCCGTTGGCGAGTCTGGCGAGAAGCCCCTGGACTAC
TGGCTGGTCAACGTCTACGGCACCATCAACCTCCTGCGCTCCATGGTGAAGCACAATGTTACCAACATTGTCTTC
TCCAGCTCCGCCACCGTCTACGGCGATGCCACCCGCTTCCCCAACATGATCCCCATCCCTGAGGACTGCCCTCTA
GGCCCTACCAACCCCTACGGCAACACCAAGTTCGCCGTCGAGACCGCCATCACCGACGCGATCAACGCCCAGCGC
AACAATGCCACCAAGGCAGGTAACGAGGCTGAGGCCAAGAAGTGGAACGGTGCTCTGCTCCGCTACTTCAACCCT
GCCGGTGCTCATCCCAGCGGTATTATGGGCGAGGACCCCCAGGGTGTCCCCTACAACCTGCTCCCCCTGCTTGCC
CAGGTCGCTACTGGCAAGCGCGAGAAGTTGATGGTCTTTGGTGATGACTACGCCTCGCACGACGGTACCGCCATC
CGCGATTACATTCACATCCTAGATCTCGCAGATGGCCACCTCAAGGCCCTGAAATACCTGCGTGCCAACAACCCC
GGTGTGCGCGCTTGGAACTTGGGTACCGGCAAGGGCAGCACTGTCTACGAGATGATCCGCGCCTTCTCCACCGCT
GTCGGAAAGGACCAGCCCTACGAGGTTGCCCCCCGTCGCGCTGGCGATGTCCTCAACCTCACTGCCAACCCCACC
CGCGCCCACACCGAGCTTGGCTGGAAGGCTGAACGTACCCTCGAGCAGGCTTGCGAGGATCTCTGGCTCTGGACT
AAGAACAACCCCGAGGGTTACCGCCAGGAGCCCCCTGCTGAGCTGCTCGCTCAGCTTAAGAAGTGA
Transcript >Pro_DTO377G3_2|g2400.t1
ATGTCTGCTGGTTCTGTTCTTGTTGCTGGTGGCACGGGCTACATTGGCTCGTTCACCACCCTGGCCCTCCTTGAG
GCTGGCTACAAGGTCGTCGTTGCCGACAACCTGTACAACTCTTCAGTCGAGGCCCTCCACCGTATTGAGCTGATC
TGCGGCAAGAAGGCCGAGTTCATCAAGCTCGATGTCACCGTGGAGAACAGCTTCGACCAAGTGTTCGAAGCTCAC
CCCGACATTGACAGCGTTATCCACTTCGCTGCCCTGAAGGCCGTTGGCGAGTCTGGCGAGAAGCCCCTGGACTAC
TGGCTGGTCAACGTCTACGGCACCATCAACCTCCTGCGCTCCATGGTGAAGCACAATGTTACCAACATTGTCTTC
TCCAGCTCCGCCACCGTCTACGGCGATGCCACCCGCTTCCCCAACATGATCCCCATCCCTGAGGACTGCCCTCTA
GGCCCTACCAACCCCTACGGCAACACCAAGTTCGCCGTCGAGACCGCCATCACCGACGCGATCAACGCCCAGCGC
AACAATGCCACCAAGGCAGGTAACGAGGCTGAGGCCAAGAAGTGGAACGGTGCTCTGCTCCGCTACTTCAACCCT
GCCGGTGCTCATCCCAGCGGTATTATGGGCGAGGACCCCCAGGGTGTCCCCTACAACCTGCTCCCCCTGCTTGCC
CAGGTCGCTACTGGCAAGCGCGAGAAGTTGATGGTCTTTGGTGATGACTACGCCTCGCACGACGGTACCGCCATC
CGCGATTACATTCACATCCTAGATCTCGCAGATGGCCACCTCAAGGCCCTGAAATACCTGCGTGCCAACAACCCC
GGTGTGCGCGCTTGGAACTTGGGTACCGGCAAGGGCAGCACTGTCTACGAGATGATCCGCGCCTTCTCCACCGCT
GTCGGAAAGGACCAGCCCTACGAGGTTGCCCCCCGTCGCGCTGGCGATGTCCTCAACCTCACTGCCAACCCCACC
CGCGCCCACACCGAGCTTGGCTGGAAGGCTGAACGTACCCTCGAGCAGGCTTGCGAGGATCTCTGGCTCTGGACT
AAGAACAACCCCGAGGGTTACCGCCAGGAGCCCCCTGCTGAGCTGCTCGCTCAGCTTAAGAAGTGA
Gene >Pro_DTO377G3_2|g2400.t1
ATGTCTGCTGGTTCTGTTCTTGTTGCTGGGTAAGTGGTTGAATTACCTATTTGGGATCTTATAGTGAGCTAATTC
CCCGCAAGTGGCACGGGCTACATTGGCTCGTTCACCACCCTGGCCCTCCTTGAGGCTGGCTACAAGGTCGTCGTT
GCCGACAACCTGTACAACTCTTCAGTCGAGGCCCTCCACCGTATTGAGCTGATCTGCGGCAAGAAGGCCGAGTTC
ATCAAGCTCGATGTCACCGTGGAGAACAGCTTCGACCAAGTGTTCGAAGCTCACCCCGACATTGACAGCGTTATC
CACTTCGCTGCCCTGAAGGTGTGTACCCGATGAATTAAGAAAGCATAAATCGTATACCCTTCGATCCAGTAGCTG
ATCCAATTGTCTTTATCCAGGCCGTTGGCGAGTCTGGCGAGAAGCCCCTGGACTACTGGCTGGTCAACGTCTACG
GCACCATCAACCTCCTGCGCTCCATGGTGAAGCACAATGTTACCAACATTGTCTTCTCCAGCTCCGCCACCGTCT
ACGGCGATGCCACCCGCTTCCCCAACATGATCCCCATCCCTGAGGACTGCCCTCTAGGCCCTACCAACCCCTACG
GCAACACCAAGTTCGCCGTCGAGACCGCCATCACCGACGCGATCAACGCCCAGCGCAACAATGCCACCAAGGCAG
GTAACGAGGCTGAGGCCAAGAAGTGGAACGGTGCTCTGCTCCGCTACTTCAACCCTGCCGGTGCTCATCCCAGCG
GTATTATGGGCGAGGACCCCCAGGGTGTCCCCTACAACCTGCTCCCCCTGCTTGCCCAGGTCGCTACTGGCAAGC
GCGAGAAGTTGATGGTCTTTGGTGATGGTATGCAAGCCCCTTCTTCCCATTATTGACACTCCCTGATCTAACACC
ATCATAGACTACGCCTCGCACGACGGTACCGCCATCCGCGATTACATTCACATCCTAGATCTCGCAGATGGCCAC
CTCAAGGCCCTGAAATACCTGCGTGCCAACAACCCCGGTGTGCGCGCTTGGAACTTGGGTACCGGCAAGGGCAGC
ACTGTCTACGAGATGATCCGCGCCTTCTCCACCGCTGTCGGAAAGGACCAGCCCTACGAGGTTGCCCCCCGTCGC
GCTGGCGATGTCCTCAACCTCACTGCCAACCCCACCCGCGCCCACACCGAGCTTGGCTGGAAGGCTGAACGTACC
CTCGAGCAGGCTTGCGAGGATCTCTGGCTCTGGACTAAGAACAACCCCGAGGGTTACCGCCAGGAGCCCCCTGCT
GAGCTGCTCGCTCAGCTTAAGAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail