Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g240.t1
Gene name
Locationscaffold_01:626783..629718
Strand-
Gene length (bp)2935
Transcript length (bp)2328
Coding sequence length (bp)2328
Protein length (aa) 776

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 1.9E-176 79 732

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

Domain # Start End Length
1 82 104 22
2 109 127 18
3 155 177 22
4 187 209 22
5 254 276 22
6 296 318 22
7 325 347 22
8 402 424 22
9 452 470 18
10 480 502 22
11 632 654 22
12 677 699 22
13 712 734 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g240.t1
MASSKDLAKDLNISEVPAADLESENTNQDPGEWLYKSDRAELTELTPVEAFKWSVEGDQSPFPEVAACVSNKDDP
TIACNTVRAWILMTVFVILFSGVNQFFGLRYPSLTIGYVVAQILVFPIGRAWEKLPRWRVPLGKLSFDVNPGKFT
IKEHAFIVICVNISATTAYAQGALVAIVSPVYWNRDLGAGFSFLYLLTTQMIGFGLTGLTRRWIVYPAALVWPTS
LSSTVLFRALHEPESRTSANGWTITRYRFFAYITAFAFVLFWFPDYIWTSLSAFAFVTWIAPDNQKVNTIFGMNS
GLGLIPISIDWTQINYAGYPLMTPFYITCNAFAVVVFFYLFLSPILYYSNVWYSAYLPLLSSSTFDNTGQSYNVS
RVLNSALDFSESKYKEYSPMYISMSYSLTYGLSFAAVTAIVVHTYLYNGTEIWERFKNARHGGEDIHRRLMRQYK
EVPEWWYGVLTVVVLGLGILTTKYWDTELPVWGFIVVCFGLAMLLIVPEGILQGTTNQRVFLNIITEMIAGYAWP
GKPIANLMVKCYGYNAVKHGMDFAQDLKLGQYMKIPPRVLFFGQIYASILATATQTGVLRWMFGHITDLCEPTNK
QRFTCNGAKVMYNASLIWGTIGPQRMFQSGQVYNGLVYFFLIGPVVTTLVYLIYRRYPNSWVRYINVPIFFNAAG
NIPPANTTQYSLWFIFGFIFNYIIRKRAFDWWKRYNYLLQAAMDTGTAIATIIIFFALGYHAVSFNWWGNTVGSN
TADSKSVPWLTVPKGSFFGKGPGEF*
Coding >Pro_DTO377G3_2|g240.t1
ATGGCGAGCTCTAAAGATCTTGCCAAAGATCTGAATATATCGGAAGTACCAGCGGCAGATCTCGAATCCGAGAAC
ACTAATCAAGATCCGGGAGAGTGGCTGTACAAATCCGACAGAGCAGAACTCACAGAGCTCACACCAGTCGAAGCC
TTCAAATGGAGTGTGGAGGGGGACCAGTCACCTTTTCCGGAGGTTGCGGCTTGTGTGTCCAACAAAGATGATCCC
ACCATCGCCTGCAATACTGTTCGGGCCTGGATATTGATGACCGTTTTTGTCATCCTTTTCTCCGGAGTGAATCAA
TTCTTCGGCCTACGATATCCTTCCCTCACAATAGGATATGTTGTCGCTCAAATCCTCGTTTTCCCGATTGGAAGA
GCATGGGAAAAGCTTCCGAGGTGGAGGGTACCTCTAGGAAAACTTTCGTTCGATGTCAACCCAGGAAAATTTACA
ATCAAGGAGCACGCGTTCATTGTTATTTGTGTCAATATCAGTGCTACCACTGCTTACGCGCAAGGTGCCTTGGTA
GCGATCGTCAGTCCCGTATATTGGAACCGGGACCTCGGAGCTGGCTTCTCATTCCTGTACCTTTTGACGACACAG
ATGATTGGGTTTGGTCTGACAGGTCTTACCCGCCGTTGGATTGTGTACCCTGCTGCCTTGGTTTGGCCTACTTCA
CTGTCATCCACTGTTCTTTTCCGAGCACTACATGAGCCAGAAAGCCGTACGTCAGCCAATGGTTGGACTATTACT
CGTTATCGCTTCTTTGCCTACATTACGGCATTTGCATTTGTCCTATTCTGGTTCCCCGACTACATCTGGACGAGT
TTGAGCGCTTTCGCCTTTGTGACGTGGATTGCGCCTGATAATCAGAAGGTCAACACGATATTCGGAATGAATTCC
GGATTAGGTTTGATACCTATCAGTATCGACTGGACACAAATAAACTACGCTGGTTACCCCCTGATGACCCCCTTC
TACATCACATGCAATGCTTTTGCGGTTGTTGTGTTCTTTTACCTTTTCTTATCGCCGATTCTGTACTACTCTAAT
GTGTGGTACAGCGCATACCTCCCTCTCCTCTCGTCCAGCACTTTCGATAACACGGGACAATCCTACAATGTATCT
CGTGTGCTCAACTCAGCCTTGGACTTCAGCGAGAGCAAGTATAAGGAGTACTCTCCCATGTACATCTCAATGTCC
TATTCTCTGACCTATGGACTGTCTTTCGCTGCGGTTACTGCAATCGTTGTGCATACATACCTTTACAATGGTACC
GAGATTTGGGAAAGGTTTAAGAATGCACGACATGGAGGTGAAGATATTCATCGCCGATTGATGCGCCAATATAAA
GAGGTTCCAGAATGGTGGTACGGAGTTCTCACGGTGGTGGTGTTGGGACTTGGTATCTTGACAACCAAATACTGG
GATACGGAGCTGCCGGTCTGGGGCTTTATTGTGGTTTGTTTCGGATTGGCAATGCTTCTGATCGTTCCCGAGGGT
ATTCTGCAAGGAACAACCAACCAGCGCGTGTTCCTCAATATCATAACGGAGATGATTGCCGGATACGCTTGGCCC
GGGAAGCCTATCGCTAATCTGATGGTGAAATGCTACGGCTATAATGCAGTGAAACACGGCATGGATTTTGCTCAG
GATTTGAAGCTCGGGCAATACATGAAAATTCCTCCGCGTGTTCTGTTCTTTGGCCAGATCTACGCTAGTATTCTA
GCGACAGCAACTCAGACTGGAGTCTTACGATGGATGTTTGGACATATTACTGACCTTTGCGAACCAACAAACAAA
CAACGCTTCACATGCAACGGTGCTAAAGTGATGTACAATGCTTCCTTAATATGGGGCACTATTGGTCCGCAGCGA
ATGTTCCAGTCTGGACAAGTGTACAATGGCCTTGTATACTTCTTCCTTATCGGGCCCGTTGTTACTACACTTGTG
TACCTTATTTACCGCCGCTATCCCAACAGCTGGGTTCGCTACATCAATGTCCCGATTTTCTTTAATGCGGCGGGT
AATATTCCTCCAGCAAACACTACTCAATATTCCCTCTGGTTCATCTTCGGTTTCATTTTCAACTATATCATCCGC
AAGCGTGCATTTGACTGGTGGAAGCGTTACAACTATTTGCTGCAAGCAGCCATGGATACCGGAACTGCTATTGCG
ACCATCATCATTTTCTTCGCGTTGGGCTACCACGCTGTCAGTTTCAACTGGTGGGGTAATACAGTGGGATCCAAT
ACGGCCGATTCTAAGTCCGTTCCCTGGTTGACAGTCCCCAAAGGCAGCTTTTTCGGAAAGGGCCCTGGCGAGTTT
TGA
Transcript >Pro_DTO377G3_2|g240.t1
ATGGCGAGCTCTAAAGATCTTGCCAAAGATCTGAATATATCGGAAGTACCAGCGGCAGATCTCGAATCCGAGAAC
ACTAATCAAGATCCGGGAGAGTGGCTGTACAAATCCGACAGAGCAGAACTCACAGAGCTCACACCAGTCGAAGCC
TTCAAATGGAGTGTGGAGGGGGACCAGTCACCTTTTCCGGAGGTTGCGGCTTGTGTGTCCAACAAAGATGATCCC
ACCATCGCCTGCAATACTGTTCGGGCCTGGATATTGATGACCGTTTTTGTCATCCTTTTCTCCGGAGTGAATCAA
TTCTTCGGCCTACGATATCCTTCCCTCACAATAGGATATGTTGTCGCTCAAATCCTCGTTTTCCCGATTGGAAGA
GCATGGGAAAAGCTTCCGAGGTGGAGGGTACCTCTAGGAAAACTTTCGTTCGATGTCAACCCAGGAAAATTTACA
ATCAAGGAGCACGCGTTCATTGTTATTTGTGTCAATATCAGTGCTACCACTGCTTACGCGCAAGGTGCCTTGGTA
GCGATCGTCAGTCCCGTATATTGGAACCGGGACCTCGGAGCTGGCTTCTCATTCCTGTACCTTTTGACGACACAG
ATGATTGGGTTTGGTCTGACAGGTCTTACCCGCCGTTGGATTGTGTACCCTGCTGCCTTGGTTTGGCCTACTTCA
CTGTCATCCACTGTTCTTTTCCGAGCACTACATGAGCCAGAAAGCCGTACGTCAGCCAATGGTTGGACTATTACT
CGTTATCGCTTCTTTGCCTACATTACGGCATTTGCATTTGTCCTATTCTGGTTCCCCGACTACATCTGGACGAGT
TTGAGCGCTTTCGCCTTTGTGACGTGGATTGCGCCTGATAATCAGAAGGTCAACACGATATTCGGAATGAATTCC
GGATTAGGTTTGATACCTATCAGTATCGACTGGACACAAATAAACTACGCTGGTTACCCCCTGATGACCCCCTTC
TACATCACATGCAATGCTTTTGCGGTTGTTGTGTTCTTTTACCTTTTCTTATCGCCGATTCTGTACTACTCTAAT
GTGTGGTACAGCGCATACCTCCCTCTCCTCTCGTCCAGCACTTTCGATAACACGGGACAATCCTACAATGTATCT
CGTGTGCTCAACTCAGCCTTGGACTTCAGCGAGAGCAAGTATAAGGAGTACTCTCCCATGTACATCTCAATGTCC
TATTCTCTGACCTATGGACTGTCTTTCGCTGCGGTTACTGCAATCGTTGTGCATACATACCTTTACAATGGTACC
GAGATTTGGGAAAGGTTTAAGAATGCACGACATGGAGGTGAAGATATTCATCGCCGATTGATGCGCCAATATAAA
GAGGTTCCAGAATGGTGGTACGGAGTTCTCACGGTGGTGGTGTTGGGACTTGGTATCTTGACAACCAAATACTGG
GATACGGAGCTGCCGGTCTGGGGCTTTATTGTGGTTTGTTTCGGATTGGCAATGCTTCTGATCGTTCCCGAGGGT
ATTCTGCAAGGAACAACCAACCAGCGCGTGTTCCTCAATATCATAACGGAGATGATTGCCGGATACGCTTGGCCC
GGGAAGCCTATCGCTAATCTGATGGTGAAATGCTACGGCTATAATGCAGTGAAACACGGCATGGATTTTGCTCAG
GATTTGAAGCTCGGGCAATACATGAAAATTCCTCCGCGTGTTCTGTTCTTTGGCCAGATCTACGCTAGTATTCTA
GCGACAGCAACTCAGACTGGAGTCTTACGATGGATGTTTGGACATATTACTGACCTTTGCGAACCAACAAACAAA
CAACGCTTCACATGCAACGGTGCTAAAGTGATGTACAATGCTTCCTTAATATGGGGCACTATTGGTCCGCAGCGA
ATGTTCCAGTCTGGACAAGTGTACAATGGCCTTGTATACTTCTTCCTTATCGGGCCCGTTGTTACTACACTTGTG
TACCTTATTTACCGCCGCTATCCCAACAGCTGGGTTCGCTACATCAATGTCCCGATTTTCTTTAATGCGGCGGGT
AATATTCCTCCAGCAAACACTACTCAATATTCCCTCTGGTTCATCTTCGGTTTCATTTTCAACTATATCATCCGC
AAGCGTGCATTTGACTGGTGGAAGCGTTACAACTATTTGCTGCAAGCAGCCATGGATACCGGAACTGCTATTGCG
ACCATCATCATTTTCTTCGCGTTGGGCTACCACGCTGTCAGTTTCAACTGGTGGGGTAATACAGTGGGATCCAAT
ACGGCCGATTCTAAGTCCGTTCCCTGGTTGACAGTCCCCAAAGGCAGCTTTTTCGGAAAGGGCCCTGGCGAGTTT
TGA
Gene >Pro_DTO377G3_2|g240.t1
ATGGCGAGCTCTAAAGATCTTGCCAAAGATCTGAATATATCGGAAGTACCAGCGGCAGATCTCGAATCCGAGAAC
ACTAATCAAGATCCGGGAGAGTGGCTGTACAAATCCGACAGAGCAGAACTCACAGAGCTCACACCAGTCGAAGCC
TTCAAATGGAGTGTGGAGGGGGACCAGTCACCTTGTAGGTTGACCCATATATCCCAACAGCCGATTTTAACACTT
CTTAGTTCCGGAGGTTGCGGCTTGTGTGTCCAACAAAGATGATCCCACCATCGCCTGCAATAGTAAGTCATTGAC
CTTCTCGGTTTGGCTGAACTAACTCTCCATCACAGCTGTTCGGGCCTGGATATTGATGACCGTTTTTGTCATCCT
TTTCTCCGGAGTGAATCAATTCTTCGGCCTACGATATGTATGTTTCAATTAACTCCACTTGGTATTTACTAACAT
CTCCTAGCCTTCCCTCACAATAGGATATGTTGTCGCTCAAATCCTCGTTTTCCCGATTGGAAGAGCATGGGAAAA
GCTTCCGAGGTGGAGGGTACCTCTAGGAAAACTTTCGTTCGATGTCAACCCAGGAAAATTTACAATCAAGGAGCA
CGCGTTCATTGTTATTGTGAGCATAAGCAAAGTTTCACGTTCTTATGAATTATATCTAACAAATCAAAACAGTGT
GTCAATATCAGTGCTACCACTGCTTACGCGCAAGGTGCCTTGGTAGCGATCGTCAGTCCCGTATATTGGAACCGG
GACCTCGGAGCTGGCTTCTCATTCCTGTACCTTTTGACGACACAGATGATTGGGTATGTGCATCCTGATTCCTCT
ATCCTATTCAGTCACTGATCATTCACAGGTTTGGTCTGACAGGTCTTACCCGCCGTTGGATTGTGTACCCTGCTG
CCTTGGTTTGGCCTACTTCACTGTCATCCACTGTTCTTTTCCGAGCACTACATGAGCCAGAAAGCCGTACGTCAG
CCAATGGTTGGACTATTACTCGTTATCGCTTCTTTGCCTACATTACGGCATTTGCATTTGTCCTATTCTGGTTCC
CCGACTACATCTGGACGAGTTTGAGCGCTTTCGCCTTTGTGACGTGGATTGCGCCTGATAATCAGAAGGTCAACA
CGATATTCGGAGTAAGCTCGCATGAATTTTGGCAATCACTACATGAAACTAATCTCGTTTTGCTTAGATGAATTC
CGGATTAGGTTTGATACCTATCAGTATCGACTGGACACAAATAAACTACGCTGGTTACCCCCTGATGACCCCCTT
CTACATCACATGCAATGCTTTTGCGGTTGTTGTGTTCTTTTACCTTTTCTTATCGCCGATTCTGTACTACTCTAA
TGTGTGGTACAGCGCATAGTAAGTTTCCAGTCTGATTGAGGGGATTCCAATATGCTGATGTTGTAGCCTCCCTCT
CCTCTCGTCCAGCACTTTCGATAACACGGGACAATCCTACAATGTATCTCGTGTGCTCAACTCAGCCTTGGACTT
CAGCGAGAGCAAGTATAAGGAGTACTCTCCCATGTACATCTCAATGTCCTATTCTCTGACCTATGGACTGTCTTT
CGCTGCGGTTACTGCAATCGTTGTGCATACATACCTTTACAATGGTACCGAGATTTGGGAAAGGTTTAAGAATGC
ACGACATGGAGGTGAAGATATTCATCGCCGATTGATGCGCCAATATAAAGAGGTTCCAGAATGGTGGTACGGAGT
TCTCACGGTGGTGGTGTTGGGACTTGGTATCTTGACAACCAAATACTGGGATACGGAGCTGCCGGTCTGGGGCTT
TATTGTGGTTTGTTTCGGATTGGCAATGCTTCTGATCGTTCCCGAGGGTATTCTGCAAGGAACAACCAACCAGCG
CGTGTTCCTCAATATCATAACGGAGATGATTGCCGGATACGCTTGGCCCGGGAAGCCTATCGCTAATCTGATGGT
GAAATGCTACGGCTATAATGCAGTGAAACACGGCATGGATTTTGCTCAGGATTTGAAGCTCGGGCAATACATGGT
ATGCCTGTTTTGTACTCTCTTGGTCGACCTTTGCTAATTATTTAGAAAATTCCTCCGCGTGTTCTGTTCTTTGGC
CAGATCTACGCTAGTATTCTAGCGACAGCAACTCAGACTGGAGGTATGATGTTTTGTCAAATCTGTGTTACATTT
TGAGCTGACGACAACAGTCTTACGATGGATGTTTGGACATATTACTGACCTTTGCGAACCAACAAACAAACAACG
CTTCACATGCAACGGTGCTAAAGTGATGTACAATGCTTCCTTAATATGGGGCACTATTGGTCCGCAGCGAATGTT
CCAGTCTGGACAAGTGTACAATGGCCTTGTATACTTCTTCCTTATCGGGGTAAGTTCTCAAACACTTTGATATTA
CTGCAGTTTACTGACTCTCCAGCCCGTTGTTACTACACTTGTGTACCTTATTTACCGCCGCTATCCCAACAGCTG
GGTTCGCTACATCAATGTCCCGATTTTCTTTAATGCGGCGGGTAATATTCCTCCAGCAAACACTAGTATGTCTCT
CTAAAGTTTCGTGGTAGGATTACTCGATCTGACCAAATAGCTCAATATTCCCTCTGGTTCATCTTCGGTTTCATT
TTCAACTATATCATCCGCAAGCGTGCATTTGACTGGTGGAAGCGTTACAACTGTGGGATCCTACCTCGTCAAGTT
TCCACTCCTGAGAATAAGTCGCTAATTCAAGACGTGGGTAGATTTGCTGCAAGCAGCCATGGATACCGGAACTGC
TATTGCGACCATCATCATTTTCTTCGCGTTGGGCTACCACGCTGTCAGTTTCAACTGGTGGGGTAATACAGTGGG
ATCCAATACGGCCGATTCTAAGTCCGTTCCCTGGTTGACAGTCCCCAAAGGCAGCTTTTTCGGAAAGGGCCCTGG
CGAGTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail