Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2376.t1
Gene name
Locationscaffold_02:2395716..2396532
Strand-
Gene length (bp)816
Transcript length (bp)711
Coding sequence length (bp)711
Protein length (aa) 237

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain 3.2E-16 8 80
PF02798 GST_N Glutathione S-transferase, N-terminal domain 1.0E-15 5 76
PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain 2.0E-15 14 77
PF00462 Glutaredoxin Glutaredoxin 5.4E-05 6 64

GO

GO Term Description Terminal node
GO:0097573 glutathione oxidoreductase activity Yes
GO:0006749 glutathione metabolic process Yes
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0006518 peptide metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009987 cellular process No
GO:0006790 sulfur compound metabolic process No
GO:0015036 disulfide oxidoreductase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0015035 protein-disulfide reductase activity No
GO:0006575 cellular modified amino acid metabolic process No
GO:0016491 oxidoreductase activity No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2376.t1
MSAPKIILYTNRVCPWAHRAHIALKELGLDYEEVTIDLNTPREPWYLKINPRGLVPTISYNGTIIAESGIVAQFL
ADAHQSHLLPPSSPTENAIYRARLSFFVDAFFSKVLPSFFASIRSADETERDAAAEQLVAAVVKEVEPLLADTEG
KGPFFGGSEKLTLAEVQAGSFLLRILSFAKPEHGLVSAKLPALLEQAPRFKRWAEATVAHDSVNFIYDEKLVADK
MRAKFAPAPKV*
Coding >Pro_DTO377G3_2|g2376.t1
ATGTCCGCCCCAAAGATCATTCTCTACACGAACCGCGTCTGCCCCTGGGCCCACCGCGCGCATATCGCCCTCAAG
GAACTCGGCCTCGACTATGAGGAAGTCACCATCGACCTAAACACCCCGCGCGAGCCATGGTATTTGAAGATCAAC
CCACGCGGCCTCGTTCCCACCATCTCCTATAACGGAACCATCATAGCCGAATCCGGCATTGTCGCCCAATTCCTC
GCAGATGCGCACCAAAGCCATCTCCTCCCACCGTCCTCGCCAACCGAGAACGCCATCTACCGCGCGCGTCTCTCT
TTCTTCGTCGACGCCTTCTTCAGCAAAGTCCTGCCTTCTTTCTTTGCCAGTATCCGCTCCGCTGATGAGACCGAG
CGCGATGCCGCCGCCGAGCAGCTGGTCGCTGCTGTCGTGAAGGAGGTTGAGCCACTCCTGGCAGACACGGAGGGC
AAGGGTCCGTTCTTTGGTGGTAGTGAGAAACTGACCCTGGCGGAGGTTCAGGCGGGCTCGTTCTTGTTGAGGATT
TTGAGCTTCGCCAAGCCTGAACATGGTCTTGTTTCGGCTAAGTTGCCCGCTTTGCTAGAGCAGGCTCCGAGGTTT
AAGCGCTGGGCTGAGGCGACGGTTGCGCATGACAGTGTTAACTTCATTTATGATGAGAAGCTTGTTGCGGATAAG
ATGAGGGCCAAGTTTGCGCCGGCGCCGAAGGTTTAG
Transcript >Pro_DTO377G3_2|g2376.t1
ATGTCCGCCCCAAAGATCATTCTCTACACGAACCGCGTCTGCCCCTGGGCCCACCGCGCGCATATCGCCCTCAAG
GAACTCGGCCTCGACTATGAGGAAGTCACCATCGACCTAAACACCCCGCGCGAGCCATGGTATTTGAAGATCAAC
CCACGCGGCCTCGTTCCCACCATCTCCTATAACGGAACCATCATAGCCGAATCCGGCATTGTCGCCCAATTCCTC
GCAGATGCGCACCAAAGCCATCTCCTCCCACCGTCCTCGCCAACCGAGAACGCCATCTACCGCGCGCGTCTCTCT
TTCTTCGTCGACGCCTTCTTCAGCAAAGTCCTGCCTTCTTTCTTTGCCAGTATCCGCTCCGCTGATGAGACCGAG
CGCGATGCCGCCGCCGAGCAGCTGGTCGCTGCTGTCGTGAAGGAGGTTGAGCCACTCCTGGCAGACACGGAGGGC
AAGGGTCCGTTCTTTGGTGGTAGTGAGAAACTGACCCTGGCGGAGGTTCAGGCGGGCTCGTTCTTGTTGAGGATT
TTGAGCTTCGCCAAGCCTGAACATGGTCTTGTTTCGGCTAAGTTGCCCGCTTTGCTAGAGCAGGCTCCGAGGTTT
AAGCGCTGGGCTGAGGCGACGGTTGCGCATGACAGTGTTAACTTCATTTATGATGAGAAGCTTGTTGCGGATAAG
ATGAGGGCCAAGTTTGCGCCGGCGCCGAAGGTTTAG
Gene >Pro_DTO377G3_2|g2376.t1
ATGTCCGCCCCAAAGATCATTCTCTACACGAACCGCGTCTGCCCCTGGGCCCACCGCGCGCATATCGCCCTCAAG
GAACTCGGCCTCGACTATGAGGAAGTCACCATCGACCTAAACACCCCGCGCGAGCCATGGTATTTGAAGATCAAC
CCAGTAAGTGACAAGCGCTCTTCCGACACCCACTCCTTATCTATACACCTACACTTCATACTACGCCTCGTATAC
TATAAACTGTTTACTAACAGCCACCTCCAACAGCGCGGCCTCGTTCCCACCATCTCCTATAACGGAACCATCATA
GCCGAATCCGGCATTGTCGCCCAATTCCTCGCAGATGCGCACCAAAGCCATCTCCTCCCACCGTCCTCGCCAACC
GAGAACGCCATCTACCGCGCGCGTCTCTCTTTCTTCGTCGACGCCTTCTTCAGCAAAGTCCTGCCTTCTTTCTTT
GCCAGTATCCGCTCCGCTGATGAGACCGAGCGCGATGCCGCCGCCGAGCAGCTGGTCGCTGCTGTCGTGAAGGAG
GTTGAGCCACTCCTGGCAGACACGGAGGGCAAGGGTCCGTTCTTTGGTGGTAGTGAGAAACTGACCCTGGCGGAG
GTTCAGGCGGGCTCGTTCTTGTTGAGGATTTTGAGCTTCGCCAAGCCTGAACATGGTCTTGTTTCGGCTAAGTTG
CCCGCTTTGCTAGAGCAGGCTCCGAGGTTTAAGCGCTGGGCTGAGGCGACGGTTGCGCATGACAGTGTTAACTTC
ATTTATGATGAGAAGCTTGTTGCGGATAAGATGAGGGCCAAGTTTGCGCCGGCGCCGAAGGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail