Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2370.t1
Gene name
Locationscaffold_02:2378202..2381643
Strand-
Gene length (bp)3441
Transcript length (bp)2295
Coding sequence length (bp)2295
Protein length (aa) 765

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 4.9E-10 398 459
PF12796 Ank_2 Ankyrin repeats (3 copies) 5.1E-09 462 525
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.2E-08 527 591
PF13637 Ank_4 Ankyrin repeats (many copies) 1.4E-09 398 450
PF13637 Ank_4 Ankyrin repeats (many copies) 1.3E-05 437 483
PF13637 Ank_4 Ankyrin repeats (many copies) 2.8E-08 498 549
PF13606 Ank_3 Ankyrin repeat 1.2E-04 496 524
PF00023 Ank Ankyrin repeat 1.4E-03 429 458
PF00023 Ank Ankyrin repeat 1.9E-04 496 526
PF00023 Ank Ankyrin repeat 1.0E-02 529 555
PF13857 Ank_5 Ankyrin repeats (many copies) 5.6E-08 483 536

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2370.t1
MGRCCTGPLQMAPGIAPSTPQGLVPLTISKPSTMSLQAGSQPWHQTTAIRLLADSLYESTRVSMALTNQAQNELG
LLLTVLSATEAYTSSLGAECVHLAVLKKRLYSCHVVLLELQKLLLHPDALGAQSLVSDIRARLSSVIFGLTEVNL
NMMISSQKIIERALRCFIDDIRAGTKEALAISDILKDSSKLEEDRIWPQLQEELVATGIASDLLTLNRDFVISTF
QKTAETYGLLPVHRENTAPVEEVLESTALSKTLELERQRSLDDKDWLADEPTGLPFLPLPPKGFSFSDKRSSYSI
QEQPYPEKETIREENFPIPVTLDMQDCTDTQKEALPVEDFPIPVLTENNQDNDMNPPIPVTEPTQPKPSLDLHAF
RVSTHSKKPRRMSRILWEMTSSREPFIVAIKANQHQTVQTLLSKGADANAQNTDGTTALMAAVSFGHEATTRLLL
EYGADMNVRALKGETALGVAAARGFDRILRMLIASGANINAGKGTGETALSQAAAYGQDRIVEMLLDCGADINAV
NSTGDTALALAALNGNMRVARLLLDRGAAVDLMRYPWQTPLYKAVQSNVLEMVRLLMERGADPYVKGGIRRTETV
VAYAGIMQRNPQTLQQCQDTQNTPSRRLHQPPYIAKIQKSFSQTIKTEALYAPTTINGPSEQHYPYRPDSTSQSP
AYDASPSTTAPLDKAYAGQPLPQYPHIQAQLQQGPGYPQQFYMPSSHPSGYATAIPLHCVQSAPCPVDCPVCGER
EMTSVESVSGGTTQ*
Coding >Pro_DTO377G3_2|g2370.t1
ATGGGGCGATGCTGCACGGGCCCTCTCCAGATGGCCCCTGGTATCGCACCCAGCACTCCGCAAGGCCTAGTCCCA
TTGACTATCTCAAAGCCCAGCACCATGTCTCTACAAGCAGGCAGTCAACCATGGCACCAAACTACCGCAATCCGA
CTATTAGCTGACTCCCTGTATGAGTCAACGCGCGTGTCAATGGCCCTAACGAACCAGGCCCAAAATGAGCTCGGC
CTGCTTCTGACCGTACTAAGCGCGACCGAGGCGTATACTTCCTCTCTAGGGGCGGAATGCGTCCATCTCGCAGTT
TTGAAAAAAAGATTGTACAGCTGCCATGTTGTCCTGCTAGAATTGCAGAAGCTGCTTCTACATCCAGATGCGCTC
GGGGCTCAGAGTCTGGTTTCTGACATTCGCGCGCGGCTCTCTTCGGTTATTTTCGGGCTTACCGAGGTGAATCTG
AATATGATGATATCATCCCAGAAGATAATTGAGCGCGCACTGAGGTGCTTTATCGATGACATTCGTGCTGGCACA
AAGGAGGCCTTGGCTATTTCTGATATTTTGAAGGATTCCTCGAAGCTTGAGGAAGACAGAATCTGGCCTCAGTTA
CAGGAAGAGTTGGTCGCTACTGGTATTGCTTCGGATTTGTTGACTCTGAACCGGGACTTCGTTATCTCGACTTTT
CAAAAGACAGCAGAGACATATGGCCTTCTGCCTGTTCACAGAGAAAACACGGCTCCGGTAGAGGAAGTCCTTGAA
TCTACGGCACTATCAAAAACTCTGGAATTAGAACGTCAGAGAAGCCTAGACGACAAGGATTGGCTAGCAGACGAG
CCAACTGGCCTCCCATTTCTCCCGCTCCCGCCAAAAGGTTTCTCATTTTCAGACAAGCGCAGCTCATATTCAATC
CAGGAGCAGCCATATCCTGAAAAAGAGACAATACGAGAAGAAAACTTCCCAATACCAGTGACGTTGGACATGCAA
GATTGCACAGATACACAGAAAGAAGCGTTACCAGTCGAAGACTTCCCCATCCCGGTTCTTACAGAGAACAATCAA
GATAACGACATGAACCCCCCAATACCAGTGACAGAACCTACCCAGCCAAAACCCTCACTAGACCTCCACGCCTTC
AGAGTTTCCACACACTCAAAAAAGCCCCGCCGAATGAGCCGCATTCTATGGGAAATGACCAGCTCAAGAGAACCC
TTCATAGTCGCCATAAAAGCCAACCAACACCAAACCGTGCAAACCCTCCTCTCCAAAGGCGCCGATGCCAACGCC
CAAAACACCGATGGCACAACAGCCCTAATGGCCGCCGTTTCCTTCGGCCACGAAGCCACAACCCGCCTTCTACTA
GAATACGGCGCAGACATGAACGTACGGGCTCTGAAAGGCGAAACAGCACTCGGCGTCGCCGCAGCGCGCGGCTTC
GACCGCATCTTGCGGATGCTGATTGCCTCAGGCGCGAATATCAATGCGGGTAAGGGGACGGGCGAGACGGCGCTC
TCGCAGGCTGCCGCGTATGGACAGGATCGGATTGTGGAGATGTTGCTGGACTGCGGGGCTGATATTAATGCTGTT
AATAGTACGGGGGATACGGCGTTGGCGCTGGCGGCGTTGAATGGGAATATGAGGGTTGCGAGGTTGTTGCTTGAT
CGTGGTGCGGCGGTCGATCTTATGCGGTATCCTTGGCAGACGCCATTGTATAAGGCTGTTCAGTCGAATGTCCTG
GAGATGGTTAGGCTTTTGATGGAGCGCGGGGCGGATCCGTATGTTAAAGGCGGGATTCGTCGGACGGAGACGGTT
GTGGCTTACGCGGGGATAATGCAGAGGAACCCCCAGACTCTACAACAATGCCAGGATACACAGAACACCCCGAGT
CGACGCCTACACCAGCCCCCGTATATTGCGAAGATCCAGAAGTCGTTTTCTCAGACCATCAAAACCGAGGCCCTC
TACGCCCCAACAACAATAAACGGCCCCTCAGAACAACACTACCCCTATCGACCTGACTCCACCAGCCAATCACCC
GCATACGATGCGTCGCCATCAACGACTGCTCCGCTCGACAAGGCATACGCAGGCCAGCCCCTGCCCCAGTACCCG
CACATACAAGCACAGCTACAGCAGGGGCCGGGCTACCCACAGCAGTTCTACATGCCTTCCAGCCATCCTAGTGGG
TATGCTACGGCCATACCGCTGCACTGTGTCCAGTCTGCACCTTGTCCGGTTGACTGTCCTGTTTGTGGAGAACGG
GAGATGACCAGTGTTGAGTCTGTGAGCGGTGGGACTACGCAGTAA
Transcript >Pro_DTO377G3_2|g2370.t1
ATGGGGCGATGCTGCACGGGCCCTCTCCAGATGGCCCCTGGTATCGCACCCAGCACTCCGCAAGGCCTAGTCCCA
TTGACTATCTCAAAGCCCAGCACCATGTCTCTACAAGCAGGCAGTCAACCATGGCACCAAACTACCGCAATCCGA
CTATTAGCTGACTCCCTGTATGAGTCAACGCGCGTGTCAATGGCCCTAACGAACCAGGCCCAAAATGAGCTCGGC
CTGCTTCTGACCGTACTAAGCGCGACCGAGGCGTATACTTCCTCTCTAGGGGCGGAATGCGTCCATCTCGCAGTT
TTGAAAAAAAGATTGTACAGCTGCCATGTTGTCCTGCTAGAATTGCAGAAGCTGCTTCTACATCCAGATGCGCTC
GGGGCTCAGAGTCTGGTTTCTGACATTCGCGCGCGGCTCTCTTCGGTTATTTTCGGGCTTACCGAGGTGAATCTG
AATATGATGATATCATCCCAGAAGATAATTGAGCGCGCACTGAGGTGCTTTATCGATGACATTCGTGCTGGCACA
AAGGAGGCCTTGGCTATTTCTGATATTTTGAAGGATTCCTCGAAGCTTGAGGAAGACAGAATCTGGCCTCAGTTA
CAGGAAGAGTTGGTCGCTACTGGTATTGCTTCGGATTTGTTGACTCTGAACCGGGACTTCGTTATCTCGACTTTT
CAAAAGACAGCAGAGACATATGGCCTTCTGCCTGTTCACAGAGAAAACACGGCTCCGGTAGAGGAAGTCCTTGAA
TCTACGGCACTATCAAAAACTCTGGAATTAGAACGTCAGAGAAGCCTAGACGACAAGGATTGGCTAGCAGACGAG
CCAACTGGCCTCCCATTTCTCCCGCTCCCGCCAAAAGGTTTCTCATTTTCAGACAAGCGCAGCTCATATTCAATC
CAGGAGCAGCCATATCCTGAAAAAGAGACAATACGAGAAGAAAACTTCCCAATACCAGTGACGTTGGACATGCAA
GATTGCACAGATACACAGAAAGAAGCGTTACCAGTCGAAGACTTCCCCATCCCGGTTCTTACAGAGAACAATCAA
GATAACGACATGAACCCCCCAATACCAGTGACAGAACCTACCCAGCCAAAACCCTCACTAGACCTCCACGCCTTC
AGAGTTTCCACACACTCAAAAAAGCCCCGCCGAATGAGCCGCATTCTATGGGAAATGACCAGCTCAAGAGAACCC
TTCATAGTCGCCATAAAAGCCAACCAACACCAAACCGTGCAAACCCTCCTCTCCAAAGGCGCCGATGCCAACGCC
CAAAACACCGATGGCACAACAGCCCTAATGGCCGCCGTTTCCTTCGGCCACGAAGCCACAACCCGCCTTCTACTA
GAATACGGCGCAGACATGAACGTACGGGCTCTGAAAGGCGAAACAGCACTCGGCGTCGCCGCAGCGCGCGGCTTC
GACCGCATCTTGCGGATGCTGATTGCCTCAGGCGCGAATATCAATGCGGGTAAGGGGACGGGCGAGACGGCGCTC
TCGCAGGCTGCCGCGTATGGACAGGATCGGATTGTGGAGATGTTGCTGGACTGCGGGGCTGATATTAATGCTGTT
AATAGTACGGGGGATACGGCGTTGGCGCTGGCGGCGTTGAATGGGAATATGAGGGTTGCGAGGTTGTTGCTTGAT
CGTGGTGCGGCGGTCGATCTTATGCGGTATCCTTGGCAGACGCCATTGTATAAGGCTGTTCAGTCGAATGTCCTG
GAGATGGTTAGGCTTTTGATGGAGCGCGGGGCGGATCCGTATGTTAAAGGCGGGATTCGTCGGACGGAGACGGTT
GTGGCTTACGCGGGGATAATGCAGAGGAACCCCCAGACTCTACAACAATGCCAGGATACACAGAACACCCCGAGT
CGACGCCTACACCAGCCCCCGTATATTGCGAAGATCCAGAAGTCGTTTTCTCAGACCATCAAAACCGAGGCCCTC
TACGCCCCAACAACAATAAACGGCCCCTCAGAACAACACTACCCCTATCGACCTGACTCCACCAGCCAATCACCC
GCATACGATGCGTCGCCATCAACGACTGCTCCGCTCGACAAGGCATACGCAGGCCAGCCCCTGCCCCAGTACCCG
CACATACAAGCACAGCTACAGCAGGGGCCGGGCTACCCACAGCAGTTCTACATGCCTTCCAGCCATCCTAGTGGG
TATGCTACGGCCATACCGCTGCACTGTGTCCAGTCTGCACCTTGTCCGGTTGACTGTCCTGTTTGTGGAGAACGG
GAGATGACCAGTGTTGAGTCTGTGAGCGGTGGGACTACGCAGTAA
Gene >Pro_DTO377G3_2|g2370.t1
ATGGGGCGATGCTGCACGGGCCCTCTCCAGATGGCCCCTGGTATCGCACCCAGCACTCCGCAAGGCCTAGTCCCA
TTGACTATCTCAAAGCCCAGCACCATGTCTCTACAAGCAGGCAGTCAACCATGGCACCAAACTACCGCAATCCGA
CTATTAGCTGACTCCCTGTATGAGTCAACGCGCGTGTCAATGGCCCTAACGAACCAGGCCCAAAATGAGCTCGGC
CTGCTTCTGACCGTACTAAGCGCGACCGAGGCGTATACTTCCTCTCTAGGGGCGGAATGCGTCCATCTCGCAGTT
TTGAAAAAAAGATTGTACAGCTGCCATGTTGTCCTGCTAGAATTGCAGAAGCTGCTTCTACATCCAGATGCGCTC
GGGGCTCAGAGTCTGGTTTCTGACATTCGCGCGCGGCTCTCTTCGGTTATTTTCGGGCTTACCGAGGTGAATCTG
AATATGATGATGTGTGTTTGTTATGTTCGTGTGTGGGTCAGTGTGGATTTTAACATTGATACAGATCATCCCAGA
AGATAATTGAGCGCGCACTGAGGTGCTTTATCGATGACATTCGTGCTGGCACAAAGGAGGCCTTGGCTATTTCTG
ATATTTTGAAGGATTCCTCGAAGCTTGAGGAAGACAGAATCTGGCCTCAGTTACAGGAAGAGTTGGTCGCTACTG
GTATTGCTTCGGATTTGTTGACTCTGAACCGGGACTTCGTTATCTCGACTTTTCAAAAGACAGCAGAGACATATG
GCCTTCTGCCTGTTCACAGAGAAAACACGGCTCCGGTAGAGGAAGTCCTTGAATCTACGGCACTATCAAAAACTC
TGGAATTAGAACGTCAGAGAAGCCTAGACGACAAGGATTGGCTAGCAGACGAGCCAACTGGCCTCCCATTTCTCC
CGCTCCCGCCAAAAGGTTTCTCATTTTCAGACAAGCGCAGCTCATATTCAATCCAGGAGCAGCCATATCCTGAAA
AAGAGACAATACGAGAAGAAAACTTCCCAATACCAGTGACGTTGGACATGCAAGATTGCACAGATACACAGAAAG
AAGCGTTACCAGTCGAAGACTTCCCCATCCCGGTTCTTACAGAGAACAATCAAGATAACGACATGAACCCCCCAA
TACCAGTGACAGAACCTACCCAGCCAAAACCCTCACTAGACCTCCACGCCTTCAGAGTTTCCACACACTCAAAAA
AGCCCCGCCGAATGAGCCGCATTCTATGGGAAATGACCAGCTCAAGAGAACCCTTCATAGTCGCCATAAAAGCCA
ACCAACACCAAACCGTGCAAACCCTCCTCTCCAAAGGCGCCGATGCCAACGCCCAAAACACCGATGGCACAACAG
CCCTAATGGCCGCCGTTTCCTTCGGCCACGAAGCCACAACCCGCCTTCTACTAGAATACGGCGCAGACATGAACG
TACGGGCTCTGAAAGGCGAAACAGCACTCGGCGTCGCCGCAGCGCGCGGCTTCGACCGCATCTTGCGGATGCTGA
TTGCCTCAGGCGCGAATATCAATGCGGGTAAGGGGACGGGCGAGACGGCGCTCTCGCAGGCTGCCGCGTATGGAC
AGGATCGGATTGTGGAGATGTTGCTGGACTGCGGGGCTGATATTAATGCTGTTAATAGTACGGGGGATACGGCGT
TGGCGCTGGCGGCGTTGAATGGGAATATGAGGGTTGCGAGGTTGTTGCTTGATCGTGGTGCGGCGGTCGATCTTA
TGCGGTATCCTTGGCAGACGCCATTGTATAAGGCTGTTCAGTCGAATGTCCTGGAGATGGTTAGGCTTTTGATGG
AGCGCGGGGCGGATCCGTATGTTAAAGGCGGGATTCGTCGGACGGAGACGGTTGTGGCTTACGCGGGGATAATGC
AGAGGAGTGAGATTCTGGGGGTTTTTGCGCAGTATGGGTATTATCCTGGGGGAGGGGGACCGGTTCGATATCAAT
ATTTCTAATGGCTTGGGGGTCTATGAGTCTGCGTATAACATCTGGCACCTAGCGTAAATCGATTTATATCTTTTT
CGGTTCGGCTTTAGGTCTTTAGTAGGCCATGTTTTGGAGTGATTGTACATCTATATCTTGTTTCATGTAGCCTTA
TCTATGTATATATCTCACTTTATATTACAATACGCCTATGCGCAATTAATATAGTGTATTCCAAATAGTAGTTGG
GGGCCAAAGATCGAGAAACTAAGGAGCATTTGCGTATAGGCCTACTCAGCCTTCAAAGGCTCAGACAGGCATTGA
TCGGCCACAACCCGTGTGATCAGGTTTGCGTTTACGATCGTCGGGGTGTAATAATGTTATAACCGCCAGTGTAAA
TGGGCTGGATTTTTATTTGAATTATTGTTGGGGCTTGGTATAATATGTACGGAATAGAATTGAGCTGCGATATGC
TAGCATCAACCGGCTTATGATGAATTGAATTATCTCTAGCCCCTTCATGTAGACCGATCCAAATATAGATTGGTC
GCAAAATAAGCCGCATACCTATCTATCAACAGCCTTTTCTGTAGATAATCCCTGTTCATGCACGGATGAGTCAAA
AGCGAGATCGACAGACCAACCCGACGGCTTTCTCTTAGTCTTCTGGCTATGTGATACTGCAAGCTTCACTTGCGT
GGCTTAGGCTTGATATCTTATAACCCTGTTCAAGGCAGTGCACTCATGGAATCCCCAGGTATCCACTGTAATACT
TACATCTTACATATTAGCCCTTGACGATCATATCGACCGCTCTATTTTTTATCATTTATCTTGTTACATTCGCAA
GCGCTGTTAGATTTCACTTAAAACCATTCAAACAAGTGAAATTTCTTGTATCCCCATCAAACTGTCTGTCTCCAG
ACCCCCAGACTCTACAACAATGCCAGGATACACAGAACACCCCGAGTCGACGCCTAGTACGCTATGAGCCCCCCA
TCATATTCTCATATAGCACGAAATAATTAACAACCTCCAGCACCAGCCCCCGTATATTGCGAAGATCCAGAAGTC
GTTTTCTCAGACCATCAAAACCGAGGCCCTGTAAGCCCACACTCAGACACATATTCACACACTGGGCAGTCCCTC
TCAGACGCCCTACGCTCCAGCTACGCCCCAACAACAATAAACGGCCCCTCAGAACAACACTACCCCTATCGACCT
GACTCCACCAGCCAATCACCCGCATACGATGCGTCGCCATCAACGACTGCTCCGCTCGACAAGGCATACGCAGGC
CAGCCCCTGCCCCAGTACCCGCACATACAAGCACAGCTACAGCAGGGGCCGGGCTACCCACAGCAGTTCTACATG
CCTTCCAGCCATCCTAGTGGGTATGCTACGGCCATACCGCTGCACTGTGTCCAGTCTGCACCTTGTCCGGTTGAC
TGTCCTGTTTGTGGAGAACGGGAGATGACCAGTGTTGAGTCTGTGAGCGGTGGGACTACGCAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail