Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2362.t1
Gene name
Locationscaffold_02:2360132..2361080
Strand+
Gene length (bp)948
Transcript length (bp)816
Coding sequence length (bp)816
Protein length (aa) 272

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain 2.0E-31 41 147
PF13534 Fer4_17 4Fe-4S dicluster domain 5.3E-09 184 257
PF13183 Fer4_8 4Fe-4S dicluster domain 5.1E-07 182 255
PF13237 Fer4_10 4Fe-4S dicluster domain 3.3E-07 184 253

GO

GO Term Description Terminal node
GO:0009055 electron transfer activity Yes
GO:0051536 iron-sulfur cluster binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0016491 oxidoreductase activity No
GO:0003824 catalytic activity No
GO:0048037 cofactor binding No
GO:0051540 metal cluster binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2362.t1
MASLRTTSRLFAASRPMFRPAFARTYATVEPTPTVQPKIKTFKVYRWNPDHPSEKPQMQSYELDLNKTGPMMLDA
LIRIKNELDPTLTFRRSCREGICGSCAMNIDGVNTLACLCRIPTDTKTESRIYPLPHTYVVKDLVPDLTHFYKQY
KSIKPYLQRDTHTADGLENRQSPEDRRKLDGLYECILCACCSTSCPSYWWNSEEYLGPAILLQSFRWLIDSRDER
TAERKAALDNSMSVYRCHTILNCTRTCPKGLNPGRAIAEIKKMLAV*
Coding >Pro_DTO377G3_2|g2362.t1
ATGGCCTCCCTCCGTACCACTTCGCGATTGTTCGCGGCGTCGCGGCCGATGTTCCGCCCTGCCTTCGCTCGCACC
TATGCGACCGTCGAGCCTACTCCCACCGTGCAACCCAAGATCAAGACCTTCAAGGTCTACCGCTGGAACCCGGAC
CACCCCAGCGAGAAGCCCCAGATGCAGTCCTACGAGCTCGATCTGAACAAGACCGGACCCATGATGCTTGACGCG
CTCATCCGGATAAAGAACGAGCTCGACCCTACCCTCACTTTCCGCAGATCTTGCCGTGAGGGTATCTGCGGTTCT
TGCGCCATGAACATCGACGGTGTCAACACTCTCGCCTGCTTGTGCCGCATTCCTACCGATACCAAGACCGAGTCG
CGCATCTACCCTTTGCCTCACACCTACGTCGTCAAGGATCTGGTCCCTGATTTGACCCACTTCTACAAGCAATAC
AAGTCCATCAAGCCATATCTCCAGCGCGATACTCACACCGCAGATGGTCTCGAAAACCGCCAATCCCCCGAGGAT
CGCAGAAAGCTTGACGGTCTCTACGAATGCATTCTGTGCGCTTGCTGCTCAACCTCCTGCCCGTCGTACTGGTGG
AACAGCGAGGAGTACCTTGGACCCGCCATTCTGCTCCAGTCCTTCCGTTGGTTGATCGATTCCCGTGACGAGAGA
ACCGCCGAGCGCAAGGCCGCTCTCGACAACAGCATGAGCGTCTACCGTTGCCACACCATTCTCAACTGCACACGG
ACTTGCCCCAAGGGCCTGAACCCAGGTCGCGCAATTGCCGAGATCAAGAAGATGTTGGCCGTCTAG
Transcript >Pro_DTO377G3_2|g2362.t1
ATGGCCTCCCTCCGTACCACTTCGCGATTGTTCGCGGCGTCGCGGCCGATGTTCCGCCCTGCCTTCGCTCGCACC
TATGCGACCGTCGAGCCTACTCCCACCGTGCAACCCAAGATCAAGACCTTCAAGGTCTACCGCTGGAACCCGGAC
CACCCCAGCGAGAAGCCCCAGATGCAGTCCTACGAGCTCGATCTGAACAAGACCGGACCCATGATGCTTGACGCG
CTCATCCGGATAAAGAACGAGCTCGACCCTACCCTCACTTTCCGCAGATCTTGCCGTGAGGGTATCTGCGGTTCT
TGCGCCATGAACATCGACGGTGTCAACACTCTCGCCTGCTTGTGCCGCATTCCTACCGATACCAAGACCGAGTCG
CGCATCTACCCTTTGCCTCACACCTACGTCGTCAAGGATCTGGTCCCTGATTTGACCCACTTCTACAAGCAATAC
AAGTCCATCAAGCCATATCTCCAGCGCGATACTCACACCGCAGATGGTCTCGAAAACCGCCAATCCCCCGAGGAT
CGCAGAAAGCTTGACGGTCTCTACGAATGCATTCTGTGCGCTTGCTGCTCAACCTCCTGCCCGTCGTACTGGTGG
AACAGCGAGGAGTACCTTGGACCCGCCATTCTGCTCCAGTCCTTCCGTTGGTTGATCGATTCCCGTGACGAGAGA
ACCGCCGAGCGCAAGGCCGCTCTCGACAACAGCATGAGCGTCTACCGTTGCCACACCATTCTCAACTGCACACGG
ACTTGCCCCAAGGGCCTGAACCCAGGTCGCGCAATTGCCGAGATCAAGAAGATGTTGGCCGTCTAG
Gene >Pro_DTO377G3_2|g2362.t1
ATGGCCTCCCTCCGTACCACTTCGCGATTGTTCGCGGCGTCGCGGCCGATGTTCCGCCCTGCCTTCGCTCGCACC
TATGCGACCGTCGAGCCTACTCCCACCGTGCAACCCAAGATCAAGACCTTCAAGGTCTACCGCTGGAACCCGGAC
CACCCCAGCGAGAAGCCCCAGATGCAGTCCTACGAGCTCGATCTGAACAAGACCGGACCCATGATGCTTGACGCG
CTCATCCGGATAAAGAACGAGCTCGACCCTACCCTCACTTTCCGCAGATCTTGCCGTGAGGGTATCTGCGGTTCT
TGCGCCATGAACATCGACGGTGTCAACACTCTCGCCTGCTTGTGTATGTATCTGGATCCGCACGCCCGAGATGTC
ATAGCATCCGACAGCTTCCGACTGAATGCTAATCCTTTGTCTGTATAGGCCGCATTCCTACCGATACCAAGACCG
AGTCGCGCATCTACCCTTTGCCTCACACCTACGTCGTCAAGGATCTGGTCCCTGATTTGACCCACTTCTACAAGC
AATACAAGTCCATCAAGCCATATCTCCAGCGCGATACTCACACCGCAGATGTGAGTTATTTTATATGCCAGCATC
ACCTCCAAAAACTAACAATTTTGCCAGGGTCTCGAAAACCGCCAATCCCCCGAGGATCGCAGAAAGCTTGACGGT
CTCTACGAATGCATTCTGTGCGCTTGCTGCTCAACCTCCTGCCCGTCGTACTGGTGGAACAGCGAGGAGTACCTT
GGACCCGCCATTCTGCTCCAGTCCTTCCGTTGGTTGATCGATTCCCGTGACGAGAGAACCGCCGAGCGCAAGGCC
GCTCTCGACAACAGCATGAGCGTCTACCGTTGCCACACCATTCTCAACTGCACACGGACTTGCCCCAAGGGCCTG
AACCCAGGTCGCGCAATTGCCGAGATCAAGAAGATGTTGGCCGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail