Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g2340.t1
Gene name
Locationscaffold_02:2310921..2314409
Strand+
Gene length (bp)3488
Transcript length (bp)3195
Coding sequence length (bp)3195
Protein length (aa) 1065

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10337 ArAE_2_N Putative ER transporter, 6TM, N-terminal 2.0E-12 36 135
PF10337 ArAE_2_N Putative ER transporter, 6TM, N-terminal 8.9E-55 140 471
PF13515 FUSC_2 Fusaric acid resistance protein-like 1.6E-16 650 787
PF10334 ArAE_2 Aromatic acid exporter family member 2 5.0E-12 791 1020

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

Domain # Start End Length
1 77 94 17
2 104 126 22
3 139 158 19
4 168 190 22
5 203 225 22
6 627 644 17
7 677 699 22
8 703 722 19
9 769 791 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g2340.t1
MANPQTHQSGSSFGSMPSQQDAQDDTSKRKTLFFGFVKKTWQKTGLDRPTILLMMKGGIPPTIAISIYQSMAVAD
EYTTLGYLVAIVSILGFAIMPRAKFIQMMIFDLLAVSIAACFALLTMFSSVRARQHTATDSTDPYNSSASAVSCL
WLFFQIWMVHTFRAKNPQLQFPVIIYAIFANIASVYAPQMKTMTAAFSMVSQLLKAFITGLGISTATSLLILPMT
SRQVVLKQMASYIGGLRSGLHAHALYFQSLERDDMFGRTETYDDAREKFGKKGKVYSPEAEAIRGAVRQITDIHA
KLHGDLTFAKREIALGKLGPDDLQAIFRHLRQIMIPVVGLSFVVDIFQRMSDYNRWNKPIDLNEPVVPEDVRRRV
VHEWNEIMRAVHDPFAVMIQTIDEGLLHTSYVFRLTKTPKRRATAKSEDDNSTEQDKDVEARADNTAPGEKAFIE
YFEKKLREFGSAKRLALQTWAEEKGVTLPPDFFDNPASAEMPTADLLDTSATQKERSQRQLYLFLYMEQLLYSTG
QTVLDFVRYADHIQAKGKLSKSRLIIPGGKRVWKWARSFLNPEDHEDDNMGDIHTQNNILQLGEAYKLRKDPEHL
PPTTSFQKIGDKIRVIPWFLRSFESTYGFRVACATMTIAVIAFLRDTQTFFTAQRLVWGLIMVNLSMSPTSGQSI
FSFVLRILGTFLAMVASLLIWYIPGKSIPGIIVFLFIFVSIAFYIPIKMFRFRAVGMISIITTTMIVGYELQVRR
VGEAVATSNGQTYYPIYLLAPYRLAVVAGGIAVAFIWTFFPYPISEHSVLRQSLGASLYLLANYYSIIHETVSGR
MRGDEGERLLKTSPGRKLEKARHKVFAKQMLMLAGLRTYSGFLRWEVPVGGRFPKKQYDSIILCVENIVNYLSLL
GYASDTIMYLGDGDNPTDTAWMTDFRRLFNAAKVTTHEVTSLLCLLSASITNRQPLPPYLKAPRPYGFANRLNEL
NSELLSLRHIAEPGFAAFAVLQISTRCIVGDMDRLLRLVKGLVGELDFSFHAVSTGESLAESRVTSRVGSRVDLS
GYASSQPDDRHKND*
Coding >Pro_DTO377G3_2|g2340.t1
ATGGCGAACCCTCAAACTCATCAGTCGGGCTCATCCTTTGGGTCAATGCCGTCGCAGCAGGATGCTCAAGATGAT
ACAAGCAAGAGGAAAACGTTATTCTTCGGTTTCGTCAAAAAAACATGGCAGAAGACGGGCTTGGACAGACCCACC
ATCCTCTTGATGATGAAGGGCGGTATTCCACCAACTATAGCCATTTCTATCTACCAATCCATGGCTGTTGCCGAC
GAGTACACGACTTTAGGCTATCTCGTGGCTATCGTCTCGATTCTGGGCTTTGCGATCATGCCCCGCGCAAAGTTT
ATCCAAATGATGATCTTTGACCTCTTGGCTGTCTCTATCGCAGCATGTTTCGCCCTGTTGACAATGTTCTCCAGT
GTCCGGGCGCGCCAACACACCGCTACTGACTCTACTGATCCATACAATTCTTCCGCGTCCGCTGTTAGCTGTTTG
TGGCTGTTCTTTCAAATCTGGATGGTTCACACCTTCCGCGCCAAAAACCCACAGCTGCAGTTCCCCGTGATTATT
TACGCGATTTTTGCAAATATTGCTTCGGTATACGCGCCGCAAATGAAGACTATGACAGCCGCGTTCAGTATGGTG
AGCCAATTGCTCAAAGCCTTCATTACTGGTCTCGGTATTTCAACAGCGACGTCGCTGTTGATCCTTCCTATGACG
TCACGGCAGGTCGTCTTAAAACAAATGGCGAGCTACATTGGCGGGCTTCGCTCGGGCTTGCATGCTCATGCTCTA
TACTTTCAATCATTGGAAAGGGATGACATGTTCGGTCGCACAGAGACCTATGATGATGCCCGTGAAAAGTTTGGC
AAAAAGGGAAAGGTCTACAGTCCCGAGGCAGAAGCAATCCGTGGTGCAGTCCGACAGATCACGGATATCCACGCT
AAACTCCACGGCGATCTCACATTTGCGAAGCGTGAGATCGCATTAGGGAAATTGGGACCAGACGATCTTCAGGCG
ATCTTCCGTCACCTTCGCCAGATTATGATCCCGGTTGTGGGGCTGAGCTTCGTGGTGGATATCTTTCAGCGCATG
TCAGACTATAACAGATGGAATAAGCCCATTGATTTAAATGAGCCTGTAGTCCCGGAGGATGTCCGACGGCGGGTC
GTGCATGAGTGGAATGAGATCATGAGGGCGGTACACGATCCCTTCGCTGTAATGATCCAAACTATTGACGAGGGA
TTACTGCATACGTCGTATGTTTTCAGGCTAACAAAGACCCCCAAACGCAGAGCTACAGCGAAATCTGAAGATGAC
AATTCAACGGAGCAAGACAAAGATGTGGAGGCCAGAGCCGATAACACTGCTCCTGGTGAAAAAGCATTTATCGAG
TATTTTGAAAAGAAACTTCGCGAATTTGGGAGTGCAAAACGCCTTGCTTTGCAGACATGGGCCGAGGAGAAGGGT
GTCACACTCCCGCCCGACTTTTTCGACAACCCTGCTTCTGCTGAAATGCCGACCGCCGATTTGCTGGATACATCA
GCTACGCAAAAAGAGCGAAGCCAGCGGCAGCTGTATCTATTTCTCTACATGGAACAATTGCTGTACTCCACCGGT
CAAACTGTGCTTGACTTTGTCCGTTATGCCGATCATATTCAGGCGAAAGGGAAGTTATCAAAGAGTCGACTCATC
ATTCCTGGTGGTAAGCGCGTGTGGAAGTGGGCCAGGTCCTTTTTGAATCCGGAAGACCACGAAGATGATAATATG
GGTGACATTCATACACAAAACAACATCCTCCAGCTTGGAGAGGCTTATAAACTTCGTAAAGACCCGGAGCATCTG
CCACCGACTACTAGTTTTCAGAAGATTGGGGACAAAATTCGTGTCATTCCATGGTTTCTGCGCTCGTTCGAGTCG
ACCTATGGCTTCCGTGTCGCATGTGCCACCATGACTATTGCAGTCATCGCCTTCCTACGTGATACCCAAACCTTC
TTTACTGCGCAAAGACTAGTCTGGGGTTTGATCATGGTCAATCTCAGCATGTCTCCCACCTCGGGACAGAGCATT
TTCAGTTTCGTGTTGCGGATTTTGGGTACATTCCTTGCAATGGTAGCCAGTCTTTTAATCTGGTATATCCCAGGT
AAAAGTATACCTGGAATTATCGTTTTCCTGTTTATCTTTGTCTCCATTGCTTTCTACATCCCCATCAAGATGTTC
CGCTTCAGGGCTGTGGGGATGATCAGCATCATCACGACAACCATGATCGTTGGTTACGAGCTTCAAGTTCGCCGA
GTCGGGGAAGCGGTCGCGACATCCAATGGACAGACCTATTACCCAATATACCTCTTGGCACCTTATCGGCTAGCT
GTTGTGGCGGGCGGTATCGCTGTCGCATTCATTTGGACGTTCTTCCCATATCCAATATCCGAGCACTCAGTTCTC
CGTCAAAGTCTAGGAGCATCGTTATATCTTCTGGCGAACTACTACTCTATCATTCACGAGACAGTCTCCGGTCGC
ATGCGTGGTGACGAGGGCGAACGTTTACTCAAGACATCTCCGGGTCGCAAACTTGAGAAAGCACGACACAAAGTG
TTCGCAAAACAGATGCTTATGCTAGCCGGTTTACGGACATACTCTGGATTCCTTCGATGGGAAGTCCCGGTCGGT
GGTCGGTTCCCAAAAAAGCAGTATGATTCGATTATTCTCTGTGTAGAAAATATCGTGAACTACCTCAGCTTGCTA
GGCTACGCATCTGATACCATCATGTATCTCGGCGACGGCGACAATCCTACAGATACCGCCTGGATGACTGATTTT
CGACGGCTGTTCAATGCTGCTAAAGTGACGACCCACGAGGTCACATCTTTGCTTTGCCTTCTTTCTGCTAGCATT
ACAAACCGTCAACCTCTACCGCCGTATCTCAAAGCACCCCGTCCTTATGGCTTCGCGAACCGCTTGAATGAACTT
AACAGTGAGCTTCTAAGCCTCCGGCACATTGCGGAGCCGGGATTCGCGGCTTTTGCTGTTCTACAAATTTCGACC
CGTTGCATTGTCGGTGATATGGACAGATTACTGCGGCTTGTCAAGGGCTTAGTGGGCGAATTAGACTTCTCTTTC
CATGCTGTAAGCACAGGAGAGTCATTGGCTGAGTCGCGAGTGACTTCTCGGGTGGGATCAAGGGTGGATTTGAGC
GGGTACGCATCATCACAACCTGATGATCGGCACAAAAACGATTGA
Transcript >Pro_DTO377G3_2|g2340.t1
ATGGCGAACCCTCAAACTCATCAGTCGGGCTCATCCTTTGGGTCAATGCCGTCGCAGCAGGATGCTCAAGATGAT
ACAAGCAAGAGGAAAACGTTATTCTTCGGTTTCGTCAAAAAAACATGGCAGAAGACGGGCTTGGACAGACCCACC
ATCCTCTTGATGATGAAGGGCGGTATTCCACCAACTATAGCCATTTCTATCTACCAATCCATGGCTGTTGCCGAC
GAGTACACGACTTTAGGCTATCTCGTGGCTATCGTCTCGATTCTGGGCTTTGCGATCATGCCCCGCGCAAAGTTT
ATCCAAATGATGATCTTTGACCTCTTGGCTGTCTCTATCGCAGCATGTTTCGCCCTGTTGACAATGTTCTCCAGT
GTCCGGGCGCGCCAACACACCGCTACTGACTCTACTGATCCATACAATTCTTCCGCGTCCGCTGTTAGCTGTTTG
TGGCTGTTCTTTCAAATCTGGATGGTTCACACCTTCCGCGCCAAAAACCCACAGCTGCAGTTCCCCGTGATTATT
TACGCGATTTTTGCAAATATTGCTTCGGTATACGCGCCGCAAATGAAGACTATGACAGCCGCGTTCAGTATGGTG
AGCCAATTGCTCAAAGCCTTCATTACTGGTCTCGGTATTTCAACAGCGACGTCGCTGTTGATCCTTCCTATGACG
TCACGGCAGGTCGTCTTAAAACAAATGGCGAGCTACATTGGCGGGCTTCGCTCGGGCTTGCATGCTCATGCTCTA
TACTTTCAATCATTGGAAAGGGATGACATGTTCGGTCGCACAGAGACCTATGATGATGCCCGTGAAAAGTTTGGC
AAAAAGGGAAAGGTCTACAGTCCCGAGGCAGAAGCAATCCGTGGTGCAGTCCGACAGATCACGGATATCCACGCT
AAACTCCACGGCGATCTCACATTTGCGAAGCGTGAGATCGCATTAGGGAAATTGGGACCAGACGATCTTCAGGCG
ATCTTCCGTCACCTTCGCCAGATTATGATCCCGGTTGTGGGGCTGAGCTTCGTGGTGGATATCTTTCAGCGCATG
TCAGACTATAACAGATGGAATAAGCCCATTGATTTAAATGAGCCTGTAGTCCCGGAGGATGTCCGACGGCGGGTC
GTGCATGAGTGGAATGAGATCATGAGGGCGGTACACGATCCCTTCGCTGTAATGATCCAAACTATTGACGAGGGA
TTACTGCATACGTCGTATGTTTTCAGGCTAACAAAGACCCCCAAACGCAGAGCTACAGCGAAATCTGAAGATGAC
AATTCAACGGAGCAAGACAAAGATGTGGAGGCCAGAGCCGATAACACTGCTCCTGGTGAAAAAGCATTTATCGAG
TATTTTGAAAAGAAACTTCGCGAATTTGGGAGTGCAAAACGCCTTGCTTTGCAGACATGGGCCGAGGAGAAGGGT
GTCACACTCCCGCCCGACTTTTTCGACAACCCTGCTTCTGCTGAAATGCCGACCGCCGATTTGCTGGATACATCA
GCTACGCAAAAAGAGCGAAGCCAGCGGCAGCTGTATCTATTTCTCTACATGGAACAATTGCTGTACTCCACCGGT
CAAACTGTGCTTGACTTTGTCCGTTATGCCGATCATATTCAGGCGAAAGGGAAGTTATCAAAGAGTCGACTCATC
ATTCCTGGTGGTAAGCGCGTGTGGAAGTGGGCCAGGTCCTTTTTGAATCCGGAAGACCACGAAGATGATAATATG
GGTGACATTCATACACAAAACAACATCCTCCAGCTTGGAGAGGCTTATAAACTTCGTAAAGACCCGGAGCATCTG
CCACCGACTACTAGTTTTCAGAAGATTGGGGACAAAATTCGTGTCATTCCATGGTTTCTGCGCTCGTTCGAGTCG
ACCTATGGCTTCCGTGTCGCATGTGCCACCATGACTATTGCAGTCATCGCCTTCCTACGTGATACCCAAACCTTC
TTTACTGCGCAAAGACTAGTCTGGGGTTTGATCATGGTCAATCTCAGCATGTCTCCCACCTCGGGACAGAGCATT
TTCAGTTTCGTGTTGCGGATTTTGGGTACATTCCTTGCAATGGTAGCCAGTCTTTTAATCTGGTATATCCCAGGT
AAAAGTATACCTGGAATTATCGTTTTCCTGTTTATCTTTGTCTCCATTGCTTTCTACATCCCCATCAAGATGTTC
CGCTTCAGGGCTGTGGGGATGATCAGCATCATCACGACAACCATGATCGTTGGTTACGAGCTTCAAGTTCGCCGA
GTCGGGGAAGCGGTCGCGACATCCAATGGACAGACCTATTACCCAATATACCTCTTGGCACCTTATCGGCTAGCT
GTTGTGGCGGGCGGTATCGCTGTCGCATTCATTTGGACGTTCTTCCCATATCCAATATCCGAGCACTCAGTTCTC
CGTCAAAGTCTAGGAGCATCGTTATATCTTCTGGCGAACTACTACTCTATCATTCACGAGACAGTCTCCGGTCGC
ATGCGTGGTGACGAGGGCGAACGTTTACTCAAGACATCTCCGGGTCGCAAACTTGAGAAAGCACGACACAAAGTG
TTCGCAAAACAGATGCTTATGCTAGCCGGTTTACGGACATACTCTGGATTCCTTCGATGGGAAGTCCCGGTCGGT
GGTCGGTTCCCAAAAAAGCAGTATGATTCGATTATTCTCTGTGTAGAAAATATCGTGAACTACCTCAGCTTGCTA
GGCTACGCATCTGATACCATCATGTATCTCGGCGACGGCGACAATCCTACAGATACCGCCTGGATGACTGATTTT
CGACGGCTGTTCAATGCTGCTAAAGTGACGACCCACGAGGTCACATCTTTGCTTTGCCTTCTTTCTGCTAGCATT
ACAAACCGTCAACCTCTACCGCCGTATCTCAAAGCACCCCGTCCTTATGGCTTCGCGAACCGCTTGAATGAACTT
AACAGTGAGCTTCTAAGCCTCCGGCACATTGCGGAGCCGGGATTCGCGGCTTTTGCTGTTCTACAAATTTCGACC
CGTTGCATTGTCGGTGATATGGACAGATTACTGCGGCTTGTCAAGGGCTTAGTGGGCGAATTAGACTTCTCTTTC
CATGCTGTAAGCACAGGAGAGTCATTGGCTGAGTCGCGAGTGACTTCTCGGGTGGGATCAAGGGTGGATTTGAGC
GGGTACGCATCATCACAACCTGATGATCGGCACAAAAACGATTGA
Gene >Pro_DTO377G3_2|g2340.t1
ATGGCGAACCCTCAAACTCATCAGTCGGGCTCATCCTTTGGGTCAATGCCGTCGCAGCAGGATGCTCAAGATGAT
ACAAGCAAGAGGAAAACGTTATTCTTCGGTTTCGTCAAAAAAACATGGCAGAAGACGGGCTTGGACAGACCCACC
ATCCTCTTGATGATGAAGTGAGTTCAGGACCAAGCCTGCAATATGCCGCAGTTGAAATCTCTAACAGCCACTATA
GGGGCGGTATTCCACCAACTATAGCCATTTCTATGTGAGTTACCAACCTCAGAAGTTCCCGGTCTGTCAGAATCA
GTCTAACCTTTAATCCAGCTACCAATCCATGGCTGTTGCCGACGAGTACACGACTTTAGGCTATCTCGTGGCTAT
CGTCTCGATTCTGGGCTTTGCGATCATGCCCCGCGCAAAGTTTATCCAAATGATGATCTTTGACCTCTTGGCTGT
CTCTATCGCAGCATGTTTCGCCCTGTTGACAATGTTCTCCAGTGTCCGGGCGCGCCAACACACCGCTACTGACTC
TACTGATCCATACAATTCTTCCGCGTCCGCTGTTAGCTGTTTGTGGCTGTTCTTTCAAATCTGGATGGTTCACAC
CTTCCGCGCCAAAAACCCACAGCTGCAGTTCCCCGTGATTATTTACGCGATTTTTGCAAATATTGCTTCGGTATA
CGCGCCGCAAATGAAGACTATGACAGCCGCGTTCAGTATGGTGAGCCAATTGCTCAAAGCCTTCATTACTGGTCT
CGGTATTTCAACAGCGACGTCGCTGTTGATCCTTCCTATGACGTCACGGCAGGTCGTCTTAAAACAAATGGCGAG
CTACATTGGCGGGCTTCGCTCGGGCTTGCATGCTCATGCTCTATACTTTCAATCATTGGAAAGGGATGACATGTT
CGGTCGCACAGAGACCTATGATGATGCCCGTGAAAAGTTTGGCAAAAAGGGAAAGGTCTACAGTCCCGAGGCAGA
AGCAATCCGTGGTGCAGTCCGACAGATCACGGATATCCACGCTAAACTCCACGGCGATCTCACATTTGCGAAGCG
TGAGATCGCATTAGGGAAATTGGGACCAGACGATCTTCAGGCGATCTTCCGTCACCTTCGCCAGATTATGATCCC
GGTTGTGGGGCTGAGCTTCGTGGTGGATATCTTTCAGCGCATGTCAGACTATAACAGATGGAATAAGCCCATTGA
TTTAAATGAGCCTGTAGTCCCGGAGGATGTCCGACGGCGGGTCGTGCATGAGTGGAATGAGATCATGAGGGCGGT
ACACGATCCCTTCGCTGTAATGATCCAAACTATTGACGAGGGATTACTGCATACGTCGTATGTTTTCAGGCTAAC
AAAGACCCCCAAACGCAGAGCTACAGCGAAATCTGAAGATGACAATTCAACGGAGCAAGACAAAGATGTGGAGGC
CAGAGCCGATAACACTGCTCCTGGTGAAAAAGCATTTATCGAGTATTTTGAAAAGAAACTTCGCGAATTTGGGAG
TGCAAAACGCCTTGCTTTGCAGACATGGGCCGAGGAGAAGGGTGTCACACTCCCGCCCGACTTTTTCGACAACCC
TGCTTCTGCTGAAATGCCGACCGCCGATTTGCTGGATACATCAGCTACGCAAAAAGAGCGAAGCCAGCGGCAGCT
GTATCTATTTCTCTACGTAAGCCTTTGCTGTTTACCCGCTTAATATGCCCGAAGCTAACATACAGTCAGATGGAA
CAATTGCTGTACTCCACCGGTCAAACTGTGCTTGACTTTGTCCGTTATGCCGATCATATTCAGGCGAAAGGGAAG
TTATCAAAGAGTCGACTCATCATTCCTGGTGGTAAGCGCGTGTGGAAGTGGGCCAGGTCCTTTTTGAATCCGGAA
GACCACGAAGATGATAATATGGGTGACATTCATACACAAAACAACATCCTCCAGCTTGGAGAGGCTTATAAACTT
CGTAAAGACCCGGAGCATCTGCCACCGACTACTAGTTTTCAGAAGATTGGGGACAAAATTCGTGTCATTCCATGG
TTTCTGCGCTCGTTCGAGTCGACCTATGGCTTCCGTGTCGCATGTGCCACCATGACTATTGCAGTCATCGCCTTC
CTACGTGATACCCAAACCTTCTTTACTGCGCAAAGACTAGTCTGGGGTTTGATCATGGTCAATCTCAGCATGTCT
CCCACCTCGGGACAGAGCATTTTCAGTTTCGTGTTGCGGATTTTGGGTACATTCCTTGCAATGGTAGCCAGTCTT
TTAATCTGGTATATCCCAGGTAAAAGTATACCTGGAATTATCGTTTTCCTGTTTATCTTTGTCTCCATTGCTTTC
TACATCCCCATCAAGATGTTCCGCTTCAGGGCTGTGGGGATGATCAGCATCATCACGACAACCATGATCGTTGGT
TACGAGCTTCAAGTTCGCCGAGTCGGGGAAGCGGTCGCGACATCCAATGGACAGACCTATTACCCAATATACCTC
TTGGCACCTTATCGGCTAGCTGTTGTGGCGGGCGGTATCGCTGTCGCATTCATTTGGACGTTCTTCCCATATCCA
ATATCCGAGCACTCAGTTCTCCGTCAAAGTCTAGGAGCATCGTTATATCTTCTGGCGAACTACTACTCTATCATT
CACGAGACAGTCTCCGGTCGCATGCGTGGTGACGAGGGCGAACGTTTACTCAAGACATCTCCGGGTCGCAAACTT
GAGAAAGCACGACACAAAGTGTTCGCAAAACAGATGCTTATGCTAGCCGGTTTACGGACATACTCTGGATTCCTT
CGATGGGAAGTCCCGGTCGGTGGTCGGTTCCCAAAAAAGCAGTATGATTCGATTATTCTCTGTGTAGAAAAGTAT
GTTATGTGCCCCCACAGCCTTTCTACGTACTAATAGTCCTTATCTTTCTAGTATCGTGAACTACCTCAGCTTGCT
AGGCTACGCATCTGATACCATCATGTATCTCGGCGACGGCGACAATCCTACAGATACCGCCTGGATGACTGATTT
TCGACGGCTGTTCAATGCTGCTAAAGTGACGACCCACGAGGTCACATCTTTGCTTTGCCTTCTTTCTGCTAGCAT
TACAAACCGTCAACCTCTACCGCCGTATCTCAAAGCACCCCGTCCTTATGGCTTCGCGAACCGCTTGAATGAACT
TAACAGTGAGCTTCTAAGCCTCCGGCACATTGCGGAGCCGGGATTCGCGGCTTTTGCTGTTCTACAAATTTCGAC
CCGTTGCATTGTCGGTGATATGGACAGATTACTGCGGTAAGCTTTCAATAGAAATTTCTTTGTTAAACCAGGCCG
GGCTTGCTAACAGTGCTATTCATTCTAGGCTTGTCAAGGGCTTAGTGGGCGAATTAGACTTCTCTTTCCATGCTG
TAAGCACAGGAGAGTCATTGGCTGAGTCGCGAGTGACTTCTCGGGTGGGATCAAGGGTGGATTTGAGCGGGTACG
CATCATCACAACCTGATGATCGGCACAAAAACGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail